KEGG   Haloquadratum walsbyi DSM 16790: HQ2295AHelp
Entry
HQ2295A           CDS       T00375                                 

Gene name
chlID
Definition
magnesium chelatase (protoporphyrin IX magnesium-chelatase) (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HQ2295A (chlID)
Enzymes [BR:hwa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HQ2295A (chlID)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1538024..1540312)
Genome map
AA seq 762 aa AA seqDB search
MANSKKTSTPVAFADIVGQDELKNALISVVVNDSLDGLLIQGEKGTAKSTAVRALQTILP
EQRVVAECSYGCPPDAPSMQCADCQERMNPSVELRPVPLITLPLGATRERVVGSLSVEAA
LEGESEFDPGLLAAANRGLLYVDEVNLLDDHLVDIILDAAASGENRVERDGVSVTHPASF
TLIGTMNPEEGDLRPQLKDRFALQATVSGLEEIPDRVDVIEQVLEDDQDADDSTDQTNIH
LSNNSTDTNSHTAVHERIVRARELLPSVTLPSSFTTDIAELCRDAGVDGHRADIATARAA
ITFAALAGRTTVIEGDVRRAAELALPHRLQSTPFEDAPDPEDVLDEHFDDEGDSTDNTAD
DADADTQKNDDDDGDGTDGNNSQVDRSQSEQSSNDDSNRSTEQGANNDDANIPEHREDRA
DIDETQDGSNRPPPQSGDSGSDESTSADNDDIDDDESHPNGESGDNQNGGDSDDESDTEQ
ITPRVPGQPSTETAVDPDQSVTRAPDINIDSQNERQNQSNDASNGGSQSGKMDTTNRGAR
VRTERAAPTDSDVDAGASIRAAASRGADQVTSRDLRQSVRAGETSALVIFAVDASASMRK
PMRTAKGVAIELLKDAYQQRDEVALVAFAGDNADVMLPPTDNVSLAARHLKELPTGDQTP
LTAGIKTTTEVLSRADPDTGIVVLVTDGRANAVGERPTAAVRSAATTLAAHNPHVVVVDA
GSRSRATVTDTIVSVTNGERIPLSALTAERVDAAVSTAQSNR
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacagtaaaaaaacttcgacgccagtcgcattcgccgacattgtcggacaggat
gaattaaagaatgcgctcatatcggttgtcgtcaacgattcacttgatggattactcatt
cagggtgagaaaggaacagcaaaatcaacagctgtgcgggcactacagacgatattgccc
gaacagcgtgtcgttgctgagtgttcatatggatgtccacctgatgcgccgtcgatgcag
tgtgcggactgtcaagagcgaatgaacccatccgtcgagctccgtccagttccactcata
acacttccactcggggcaactcgggagcgagttgtcgggagtctctcggttgaggctgcg
cttgagggtgagtctgaattcgatccagggttacttgcagctgccaatcgtggcttattg
tatgttgatgaggtaaatcttcttgatgatcatcttgtagatataatacttgatgctgct
gcaagcggtgagaatcgggttgaacgtgatggagtcagcgttactcatccggcttcattt
acccttatcgggacgatgaatcccgaagagggtgaccttcgaccacagttgaaggatcga
ttcgcgttacaagcaactgtcagcggacttgaagagattcccgaccgggtcgatgtaatc
gaacaggtacttgaggatgatcaagacgctgatgattcaacagatcaaactaacatacat
ttatctaataattctacagacacaaacagtcacaccgctgttcatgagcgaatcgttcgt
gctcgcgagttgcttccatcggttacgcttccatcgtcgttcacaaccgatattgcagag
ctctgtcgtgacgccggtgttgacggtcatcgcgctgatatcgcaacagctcgcgctgca
atcacgtttgctgcacttgcaggacggacgacagtcatcgagggggatgtccgccgagca
gctgagcttgcacttccacatcgactacagtcaacaccatttgaagatgcaccggatcca
gaggatgttctcgatgaacacttcgacgacgaaggagatagcaccgataatacggcagat
gatgcggatgcagatacacaaaagaatgatgatgacgatggtgacggtactgacggaaat
aattctcaagttgatcgctcacaatcagagcagtcatcaaatgatgacagcaacaggagt
actgagcagggtgcaaataatgatgacgcgaatattcctgaacatcgtgaggatagggca
gatatcgatgaaactcaagatgggtccaatagaccgccaccacaatcaggtgattcggga
tcggatgagagcacatctgcggataatgatgacatagatgatgatgaatcccatcctaat
ggtgaatctggggataatcaaaatggtggtgatagtgatgatgaatccgatactgaacag
ataacgccacgagttcctggacagccatctactgagacggcagtagatccggatcaatcg
gtgacacgagctcctgatatcaatattgattcgcagaatgaacgacagaatcaatcaaat
gatgcgtcgaatggtgggtcgcagtcgggaaaaatggatacaacaaaccgtggtgcccgt
gttcggaccgaacgagcagcaccaacagattctgatgttgatgctggtgcctcgattcga
gcggctgcctcacggggagcagatcaagtaacgtctcgggaccttcgacagtcggttcgt
gcaggcgaaacatcagcactagtgatttttgctgttgatgcgagtgcttcaatgcgtaag
ccgatgcggacagcaaaaggcgtcgcaattgaattgctgaaggatgcatatcaacaacgt
gatgaagtagcactcgttgcatttgcaggcgataatgctgacgtcatgcttccaccaaca
gataatgtaagcttagccgcacgccatctcaaagagttgccgaccggtgatcaaacacca
ctcaccgcgggaatcaagacaacaacagaagtgctctcacgtgcagaccctgatactggg
attgtcgtacttgtcactgatggtcgtgcgaacgctgttggagagcgaccgacagctgca
gttcgttcagccgcgacgactctcgcagcacataatccacacgtcgttgtcgttgatgcc
gggtcacgctcgagagccacagtcactgatacgattgtttcggtaacgaatggtgagcgg
attccactgtcggcactaacagctgaacgcgttgatgcagcggtttctactgcacagagc
aatagataa

DBGET integrated database retrieval system