KEGG   Haloquadratum walsbyi DSM 16790: HQ2366AHelp
Entry
HQ2366A           CDS       T00375                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HQ2366A (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ2366A (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HQ2366A (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HQ2366A (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HQ2366A (adh)
   00626 Naphthalene degradation
    HQ2366A (adh)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HQ2366A (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1607579..1608604
Genome map
AA seq 341 aa AA seqDB search
MDNMSEKMQAAVVSEPGAEFDLVERPVPEPDSEEVRIAVEACGICHSDVFVKEGTYPGVK
YPRVPGHEVAGRIDAVGADVNMWEIDDRVGVGWHGGHCFDCDPCRRGDFQQCVDAKVTGL
TYDGGYAEYTTVPAEAVAAVPEELNAVEAAPLLCAGVTTYNALRHTDARPGDLVAVQGIG
GLGHLGIQYAHAAGFETVALSRSADKESLAKDLGADHFIDATAVDPAERLTELGGASVIL
ATAPASDAISSVVSGLGADGSVVVVGIPGEPIEASGQDLVGARSSVEGWASGDARDSQDT
LEFSALRSITPEVETYSLDEVTTAYSQMIENEARFRAVIEP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggataatatgtctgagaaaatgcaagcggctgttgtctccgagccgggagcagaattt
gatcttgttgagcgtccggtcccagagcctgactcggaggaagttcgtattgctgttgag
gcgtgtggcatctgtcacagtgatgtgtttgtcaaagagggaacctatccgggggtcaag
tacccacgagttccaggtcatgaagtcgcaggacggattgacgctgtcggagcagatgtg
aatatgtgggagattgatgaccgcgttggtgttggatggcatggtggtcactgtttcgac
tgtgatccatgccggcgtggtgacttccagcaatgtgttgatgccaaagtaacgggattg
acatatgacggaggatatgctgaatatacgactgttcccgccgaggcagtggctgcggtc
cctgaggaattaaatgctgttgaggcagccccactactctgtgccggcgtgacgacatat
aacgccctcagacataccgacgcccgcccaggcgatcttgttgctgtacaaggaattggt
gggcttggtcaccttggtattcaatatgcgcacgcagcagggtttgagacggtcgcactt
tcacgaagcgcagacaaagagtcacttgcgaaggatctcggtgctgatcattttattgat
gcaaccgcggttgatccagcagaacggctcactgaacttggtggcgcctcagttattctt
gcaactgctcctgcgagtgatgcaattagcagtgtcgttagtgggcttggagccgatggg
tctgttgttgttgttgggattccaggtgaaccaatcgaagccagcggacaggatcttgtc
ggagcgcgaagtagcgtcgaggggtgggcgtctggggatgcacgcgactcacaggataca
cttgaattcagtgctcttcgctcgattacccctgaagttgagacatactcactcgatgag
gtgacgacagcttacagtcagatgattgagaatgaagcacgctttcgtgctgtcattgaa
ccctga

DBGET integrated database retrieval system