KEGG   Haloquadratum walsbyi DSM 16790: HQ2381AHelp
Entry
HQ2381A           CDS       T00375                                 

Definition
beta,beta-carotene 15,15'-monooxygenase; beta-carotene dioxygenase 1 (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1622028..1623485)
Genome map
AA seq 485 aa AA seqDB search
MSTHPGFHSLTTETDTSISVEGSLPSWLTGTLIRNGPGAFSFPEGSSVDHWFDGLAMLTR
FTFEPVDGADDVIHYQNRFLRTDAYADAREGEFTGGFATGETTLRSRLAGFLTAPYDNTN
IIIERVDNTFLALTESPRSVSVDPTTLETDGHIEYDGTEPTGQLRCAHFRRDPATGTLLT
VDTSFGRTNEYHIYTLDSTDSQTHVGSVPTEKPAYMHSFGLTPRYVILTEFPLRLDPLQF
LRPGRQDPFIEQFEWEPDRGTRIIIIDRTTGDIVAEPVVDPVFGFHHINAFERDGGRTVV
FDLETVPDDTSIDSLYLDTLRNGELGTLAGRLERFVVDLGSIADDRYGNPTATVSQQMLY
DDGTALPTASPAQWCQPHRYIYAMSMEQPVTEWAQAVMKFDTHTTHSIEYQQGADYFSEP
IFVPNPTGNSRDDGVVLTLGLDADQDRSRLFVLSGDTLAERARITLPHAVPFDFHGRYFP
NVHVA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcatccgggatttcactcactcacaaccgaaacggatacgtcaatatcagtt
gagggatcactcccatcatggctcactggaacactcattcgaaacggaccaggagcattt
tcattccccgagggaagctcagttgatcattggttcgatgggcttgcaatgctcacgcga
tttacctttgagcctgtggacggcgcagatgatgtaattcactatcagaaccgatttctc
cgaacagatgcatacgcggatgcccgcgaaggagagtttaccggggggttcgcaaccggt
gaaacaacacttcgatcgcgtctcgctggatttctgacagcgccatatgataatacaaat
attattatcgaacgtgttgacaatacattccttgctcttactgaatcgccccgaagcgtc
tcagtcgatccaacaacactcgaaacagatgggcacattgaatatgatggcacagaacca
accgggcagttacgatgtgcacatttccgacgtgacccagcaacagggacactcctgact
gtcgatacatcatttggtcggacgaatgaatatcatatttatacactcgatagcactgat
tcacagacgcatgtcgggagtgtccccactgagaaaccagcatatatgcatagcttcggt
ctcacacctcgatatgttattctgacagaatttccactccggcttgacccactccaattc
ctacgcccgggtcgtcaagatccatttattgaacagtttgagtgggaacctgatcgtggg
acacgaatcatcatcattgaccgaacaaccggcgatatcgttgctgaacctgttgttgac
ccagtgtttgggtttcatcatatcaatgcattcgagcgagatggcggtcgtacggtggta
tttgatcttgagacagtccctgatgatacatcgattgattcattatatcttgatacactg
cgtaacggtgagttggggacgcttgccggtcggcttgagcggtttgtcgtcgaccttggg
tcgatagctgatgaccgatatggcaatcctactgcaacagtcagccagcagatgttatat
gatgatggaactgctcttccgacagcatcaccagcgcagtggtgtcagccacatcgctat
atttacgcgatgagcatggagcaaccggtaacagagtgggctcaagcagtgatgaaattc
gacactcacacgacacattcaattgaatatcaacagggtgctgattactttagtgagcca
atttttgtccccaatccaactggtaattcacgcgatgatggcgttgttcttacactcgga
cttgatgctgaccaagatcgatcgcggctgttcgtgctgtctggtgacacactcgccgaa
cgcgcccgaattactctcccgcatgctgtgccgtttgatttccatggaagatatttcccg
aatgtccacgttgcctga

DBGET integrated database retrieval system