KEGG   Haloquadratum walsbyi DSM 16790: HQ2923AHelp
Entry
HQ2923A           CDS       T00375                                 

Gene name
celM
Definition
cellulase; endo-1,3(4)-beta-glucanase (EC:3.2.1.4 3.2.1.6)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01180  
endo-1,3(4)-beta-glucanase [EC:3.2.1.6]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HQ2923A (celM)
Enzymes [BR:hwa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     HQ2923A (celM)
    3.2.1.6  endo-1,3(4)-beta-glucanase
     HQ2923A (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224058..2225128)
Genome map
AA seq 356 aa AA seqDB search
MDDTRREFLTDLLTTPSPSGFETVGQRVWVKYVQQFADEVNTDAYGNAVAVYHGDPACDV
SIAFAGHADEIGYIIRDITDDGYLRINRIGGADRTVSKGQHVTVHSETPVAGVIGQTAIH
LRDTGNESYDDIDEQFIDIGAEDGDAARERVEVGDPVTVETRVRPLADTRLAARALDNRV
GIWAAAEALRAAATRTQSVDATVYAVSTVQEEVGVQGAKMVGFDLDPDAAVAIDVTHATD
NPDLPGNSVGPVELGSGPVVTRGSVNHPTLVTLARDAAETAEVDVQLQAAGSRTGTDADA
FYTSRSGIPALNIGIPNRYMHTPVEVIDTTDLDAIASLTGAMAAGADDIAPFTLDV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatgataccagacgtgaattcttgacagatttattgacgacaccaagtccatcagga
ttcgaaacagttggtcaacgagtatgggtgaagtacgttcaacagtttgccgatgaagtg
aataccgatgcctatggcaatgctgttgcagtttatcacggcgaccctgcttgcgatgtc
tccattgcctttgccggtcatgcagacgaaatcggatatatcattcgtgacatcactgat
gatggatatcttcgtatcaatcgcattggtggtgctgaccgaaccgtctcaaaaggacaa
catgtaacggttcactctgaaacccctgttgctggcgtcattggtcagactgcaatccac
cttcgtgatactggtaatgagtcatatgacgatattgatgagcaattcatcgacatcggt
gctgaggacggtgatgcagcacgtgagcgtgtcgaagtcggcgatccagtcaccgttgaa
actcgggttcgaccgcttgctgatacacggcttgcagcgcgtgcgcttgataatcgcgtt
ggtatctgggctgccgctgaggcgcttcgggctgctgcaacacgcacgcagtctgtcgat
gcaacggtctatgctgtcagtaccgtccaggaggaggttggcgttcaaggagcgaagatg
gttggatttgatcttgacccagatgcagcagttgcgattgacgtgactcacgcaaccgat
aatcctgatcttccaggaaatagcgttggtccagttgagcttggatccggacctgtcgtc
acccgtggcagcgtgaaccacccgacgttggtgacacttgcacgtgatgcagcagaaaca
gcagaggttgatgtccaactacaagcagcaggatcccgaaccgggactgatgctgacgca
ttttatacgagtcgaagcggcattccagcattgaatatcggtattccgaatcgatacatg
cacacaccggtcgaggttattgatacaactgatcttgatgctattgcatcgcttactggt
gcgatggctgcgggtgctgatgatattgcaccatttaccctcgacgtctag

DBGET integrated database retrieval system