KEGG   Haloquadratum walsbyi DSM 16790: HQ2996AHelp
Entry
HQ2996A           CDS       T00375                                 

Gene name
sdhD
Definition
succinate dehydrogenase, subunit D (membrane anchor protein) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ2996A (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HQ2996A (sdhD)
   00650 Butanoate metabolism
    HQ2996A (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HQ2996A (sdhD)
   00720 Carbon fixation pathways in prokaryotes
    HQ2996A (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2297381..2297752)
Genome map
AA seq 123 aa AA seqDB search
MAEHYSSFKRGGRRWLWQRITAAFLVVVLAFHFFLLHFVHHADEVTFAMSQGRMQELTYF
SLMVLFLVTATFHGVNGVYNALINQGLSGTRRKATKVVLGVASIVLIVQGVRTAIAWAGG
IPI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacactactcttcattcaaacgcggcggtcgtcgatggctgtggcagcgcatc
acggcggcattcctcgtggtggtattagcatttcatttcttcttactccactttgtccac
catgctgatgaggttaccttcgcgatgtcacaggggcgaatgcaggaactgacgtatttc
tcgttgatggtcctctttcttgtcactgcaacattccatggcgtcaacggcgtttataat
gcgctgattaaccagggcctctcaggcacccggcgaaaagcaacaaaggtcgttcttggc
gtagccagtatcgtcttgattgtacagggcgtccgaaccgcaattgcgtgggctggcggg
ataccaatctaa

DBGET integrated database retrieval system