KEGG   Haloquadratum walsbyi DSM 16790: HQ3094AHelp
Entry
HQ3094A           CDS       T00375                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ3094A (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HQ3094A (aceA)
Enzymes [BR:hwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HQ3094A (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2409648..2410682
Genome map
AA seq 344 aa AA seqDB search
MNPTELDDNVFNRDIDNPQGEKFRNQLNNQDFVFAPGMYHALDARIAEMTGHDAAYMSGY
STVLGQFGFPDLEMVTMTEMVENAKRMAEATNLPIIADCDTGYGGIHNVRRAVREYEKAG
VAAVHIEDQTTPKRCGHIAGKQIIPREKAEARFTAAVDAKQSEDTVVIARTDAYGSANGD
WEEHLERGRMYADAGVDLVWPEMPNPSREDAVNYAETIHETHPDLKLAFNYSSSFAWSEE
DDPLTFQELGDLGYKYIFITLAGLHSGAHAVYEDFKKLAEADETGQFELEDRYLEHPTES
HHELSFVSRYQDIETKFDPEARRRIEQSEGFSDEETDPITSDDD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaacagaactcgacgataatgtctttaatcgcgatattgacaacccacagggt
gaaaagttccgtaatcagctaaataaccaggattttgtcttcgctcctgggatgtatcat
gcacttgatgctcgaattgcggagatgaccggtcacgatgctgcgtatatgtctggatac
tcgacagtgttgggacaatttgggtttcccgatcttgagatggtcacaatgactgaaatg
gttgagaacgcaaaacgaatggctgaggcgacaaaccttccaatcattgctgactgtgac
accggatatggtggcatacataatgtccgtcgtgcggttcgtgaatatgaaaaagcaggt
gtggctgctgttcatatcgaagatcaaacaacgccaaaacgctgtggacatattgctggc
aaacaaattatcccacgcgaaaaggctgaagcgcggtttaccgcggctgttgatgcaaaa
cagtctgaggatacagtcgttattgctcgaacagacgcctacggttcagcaaatggtgac
tgggaagaacatcttgaacgtggacggatgtatgcagatgctggtgttgatcttgtgtgg
cctgagatgccaaatccaagccgtgaagatgctgtcaactacgctgaaacgattcatgag
acacatccagatctcaaacttgcgttcaattactcatcgtcatttgcatggtccgaagaa
gatgacccacttaccttccaagaacttggtgatcttggatataaatacatcttcattaca
cttgccggattacactctggtgcacatgccgtttatgaagatttcaagaaactagccgag
gcagatgagactggacagttcgaacttgaggaccgatatcttgagcatccgaccgagagt
catcatgaactttcattcgtctcgcgatatcaggatatcgagacaaaattcgaccccgag
gcgcgtcgccgaattgaacaatctgagggattcagtgatgaagagactgatcccatcacg
agtgatgatgattga

DBGET integrated database retrieval system