KEGG   Haloquadratum walsbyi DSM 16790: HQ3108AHelp
Entry
HQ3108A           CDS       T00375                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ3108A (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ3108A (glcK)
   00052 Galactose metabolism
    HQ3108A (glcK)
   00500 Starch and sucrose metabolism
    HQ3108A (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    HQ3108A (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HQ3108A (glcK)
   00524 Butirosin and neomycin biosynthesis
    HQ3108A (glcK)
Enzymes [BR:hwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HQ3108A (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2426852..2427820)
Genome map
AA seq 322 aa AA seqDB search
MSYYVGVDLGATNVRAVVAGEDGSVYGRSDDTTPGGPTGIAVTEAVLGVVREACADATIA
PDSVSAAGIGAIGPLDLAAGAVENPANLPDTIDQIPLTGPLSVLLDTKQVFLHNDTNAGV
IGERFYADRNPDDMVYLTISSGIGAGVCVDGSVLTGWDGNAGEIGHMTVDPQGRLTCGCG
HDGHWEAYCSGNSIPRYAKQLYETNPIETAIPIDDPALSAVDIFQYAPDDEFASYVLDRL
AHWNAMGVANIVHAYAPLVIYVGGAVALNNPAAVLQPIRNQMDEMVMSNVPEIKLTTLGD
EVVVRGALASALTAGTGDRSQM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactacgtgggcgttgatcttggcgcgaccaacgtccgtgcggttgtcgccggt
gaggacggatcggtatacggtcgcagcgatgacacgacgccgggtggaccaacaggtatt
gcagttacagaagcagttctcggtgttgttcgcgaagcgtgtgccgatgcaactattgcc
cctgattcagtttcagcggctggaatcggtgcaatcggtccacttgatcttgccgccggc
gctgttgaaaatcctgcaaatcttccggacacaattgatcagattccacttacaggtcca
ttatcagtgttactcgatacgaaacaggtatttcttcataacgatacaaacgcgggggta
attggtgagcgcttctatgctgatcgaaatccagatgacatggtatatctcacgatttca
tcagggatcggagcgggggtgtgtgtcgatggaagtgttctcacggggtgggacgggaac
gcgggcgaaattggacatatgaccgttgacccacagggtcgattaacctgtggttgcggg
cacgatggtcactgggaagcatactgttcgggaaatagtattcctcggtatgcaaagcaa
ttgtatgaaacaaatccgattgagacagccattccaattgatgatccagcgctctccgcg
gttgatatctttcaatatgcacctgatgatgaattcgcatcgtatgtgcttgaccgactc
gcacactggaatgcaatgggcgttgcaaatattgttcatgcatacgcaccattagttatc
tatgttggcggtgccgttgcattaaataatcctgctgcagtgttgcaaccaatccgtaat
caaatggatgaaatggtgatgtcaaatgtgccagaaataaagctcacaacacttggggat
gaagtcgttgttcgtggcgcactcgcgagtgcattaactgctggcaccggggatcggtcc
caaatgtga

DBGET integrated database retrieval system