KEGG   Haloquadratum walsbyi DSM 16790: HQ3153AHelp
Entry
HQ3153A           CDS       T00375                                 

Gene name
cofE
Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:hwa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2477056..2477796
Genome map
AA seq 246 aa AA seqDB search
MELFAVSNLPEVNEGDDLAALITEQVDLRSDDIICVASTIISKAEGRTANLDRFSPGPRA
RELTTALDSDIDPRFTQAVLEESVEVILESPFLLTETRFGHIGVNAGIDRSNVPDADLLL
LPKSPTESAQRLHEGLPANRIIVTDTCGRPFRHGQRGVALGWAGLPPARDWRGETDRDGR
ELSATVENVVDELAAASNLLTGEGDDGTPVVVIRDFEWGDHGSSDAHFRDVDTDFVRQAV
RGWSYA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaattgtttgcagttagtaatcttccagaggtgaatgagggtgatgacctcgcagcg
ttgattactgaacaggttgatctcagatcagacgatatcatttgtgttgcttcaacgatt
atttcaaaagctgagggacggactgcgaatctcgaccgtttttcaccgggtccacgtgct
agagaactcacaacggcgcttgattcagacatagatccgcgattcacccaagctgttctt
gaagagagtgttgaagttattcttgaatcaccattcctcctcactgagacacggtttggt
cacatcggagtcaacgcagggattgatcggtcaaacgttcctgacgcagacttattatta
ctgccgaaatcgccgacagagagtgctcagcgtcttcatgagggattaccagctaatcgg
attatcgttaccgatacatgcgggcgaccgtttcgtcatggacagcgcggtgttgcactc
ggctgggcagggcttccaccagctcgtgattggcggggggaaacagaccgagacggtcgt
gagctgagtgcaaccgtcgagaacgtcgttgacgagcttgctgctgcgtcaaatcttctc
acaggcgagggtgatgatggaacacctgtcgttgttattcgtgacttcgagtggggtgat
catggaagtagtgatgctcactttcgagatgtcgatacagactttgtgcgccaggctgtc
cgggggtggtcatatgcgtga

DBGET integrated database retrieval system