KEGG   Haloquadratum walsbyi DSM 16790: HQ3153AHelp
Entry
HQ3153A           CDS       T00375                                 

Gene name
cofE
Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    HQ3153A (cofE)
Enzymes [BR:hwa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     HQ3153A (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     HQ3153A (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2477056..2477796
Genome map
AA seq 246 aa AA seqDB search
MELFAVSNLPEVNEGDDLAALITEQVDLRSDDIICVASTIISKAEGRTANLDRFSPGPRA
RELTTALDSDIDPRFTQAVLEESVEVILESPFLLTETRFGHIGVNAGIDRSNVPDADLLL
LPKSPTESAQRLHEGLPANRIIVTDTCGRPFRHGQRGVALGWAGLPPARDWRGETDRDGR
ELSATVENVVDELAAASNLLTGEGDDGTPVVVIRDFEWGDHGSSDAHFRDVDTDFVRQAV
RGWSYA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaattgtttgcagttagtaatcttccagaggtgaatgagggtgatgacctcgcagcg
ttgattactgaacaggttgatctcagatcagacgatatcatttgtgttgcttcaacgatt
atttcaaaagctgagggacggactgcgaatctcgaccgtttttcaccgggtccacgtgct
agagaactcacaacggcgcttgattcagacatagatccgcgattcacccaagctgttctt
gaagagagtgttgaagttattcttgaatcaccattcctcctcactgagacacggtttggt
cacatcggagtcaacgcagggattgatcggtcaaacgttcctgacgcagacttattatta
ctgccgaaatcgccgacagagagtgctcagcgtcttcatgagggattaccagctaatcgg
attatcgttaccgatacatgcgggcgaccgtttcgtcatggacagcgcggtgttgcactc
ggctgggcagggcttccaccagctcgtgattggcggggggaaacagaccgagacggtcgt
gagctgagtgcaaccgtcgagaacgtcgttgacgagcttgctgctgcgtcaaatcttctc
acaggcgagggtgatgatggaacacctgtcgttgttattcgtgacttcgagtggggtgat
catggaagtagtgatgctcactttcgagatgtcgatacagactttgtgcgccaggctgtc
cgggggtggtcatatgcgtga

DBGET integrated database retrieval system