KEGG   Haloquadratum walsbyi DSM 16790: HQ3360AHelp
Entry
HQ3360A           CDS       T00375                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ3360A (tpiA)
   01230 Biosynthesis of amino acids
    HQ3360A (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ3360A (tpiA)
   00051 Fructose and mannose metabolism
    HQ3360A (tpiA)
   00562 Inositol phosphate metabolism
    HQ3360A (tpiA)
Enzymes [BR:hwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HQ3360A (tpiA)
Exosome [BR:hwa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HQ3360A (tpiA)
  Exosomal proteins of bladder cancer cells
   HQ3360A (tpiA)
  Exosomal proteins of melanoma cells
   HQ3360A (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2722461..2723105)
Genome map
AA seq 214 aa AA seqDB search
MFILINLKAYPCDPLEIANAARDVANDSGVRIAVSPQAADIARVSDTGVETWAQHVSANN
YGSYTGSTLAEAVANAGATGTLINHSERRLTLADIDTAVNAASRVDLDTCVCANNPAQIG
AVTALSPDSVAVEPPALIGGDASVATADPDIVSNAVESTNSIDKTVDVYCGAGISAGDDV
IAARDLGASGILLASGVAKADNPRKALEDLVVPI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcttaatcaatctcaaggcatacccgtgtgacccactcgaaatcgcgaacgca
gctcgagatgttgctaatgattccggagttcgtattgccgtatcaccacaggcagccgat
attgcgcgtgtctcggataccggtgtcgagacatgggcacagcatgttagcgcaaataac
tacgggagttacactggtagtacacttgcggaggctgttgcaaacgccggagcaactgga
acactaatcaatcactccgagcggcgactcacacttgctgatattgatacagccgtcaac
gcagcatcgcgtgttgatcttgatacgtgcgtctgtgcgaacaacccagcacagattggg
gcagtgacagcacttagtccagacagcgtcgctgttgaaccaccagcgctcattggtgga
gatgcatccgttgcaacagctgatccggatattgtctccaatgctgttgagtcaacaaat
agtattgataaaacagttgatgtctactgtggagccggaatctctgctggtgatgatgtt
atcgctgctcgtgatctcggtgcaagtggtattctgcttgcatctggggttgcaaaggca
gataatcctcgaaaagcacttgaggacctcgtagttcccatataa

DBGET integrated database retrieval system