KEGG   Haloquadratum walsbyi DSM 16790: HQ3452AHelp
Entry
HQ3452A           CDS       T00375                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HQ3452A (hemD)
Enzymes [BR:hwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HQ3452A (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2820843..2821628
Genome map
AA seq 261 aa AA seqDB search
MVTAVELLEEYGITPIPDPMLSVEPTGTIPEIDTVSDASPFVVLTSKTGVEILADAGWNP
TVATLVCIGPRTAAAARDVGWTVDIIPTEYSSQGLVDALADQVTDRSVIIARSDHGSETL
IDGLDAAGAAVTETVLYKLVRPDGTGQSTVMAAGNELDAVCFTSSLTVEHFLSAAANREL
REETIMGLNNAVVGTIGEPTRETAQAHGVRVDVTPADATFEHLVEAVVNELQTGQLSSDI
DETDVADNKTESVESYDDRQV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcactgcggttgagctacttgaagagtatggaatcacacccattccggacccgatg
ttatcggttgagccgaccggcacaatccccgagatagacaccgtatcagacgcatcgcca
tttgttgtgttgaccagtaaaactggtgttgagattctcgcagacgctgggtggaatccc
accgtggcaacattggtatgcattggaccacggaccgccgctgcagcccgcgatgttgga
tggactgtagatataatcccaacagaatattcctcgcaagggttagttgatgcactcgca
gatcaagtaacagaccggtcagttattattgcacgaagcgatcacggaagtgagacactc
attgatggattagatgcagccggagcggctgtcacggagacggtcctttataaacttgtg
cgacccgatgggaccggacaatcgacggtgatggctgctggtaatgaattggatgcagtt
tgttttacatcatcgctgacagttgaacactttctctcggctgccgcaaacagagagctc
cgtgaagaaacgattatggggcttaataatgctgttgttgggacaatcggagagccgact
cgagaaacagcccaggcacatggagttcgggtcgatgtaacgccagcagatgcaacattc
gagcatcttgttgaggctgtcgtgaatgagcttcaaacaggacagttgtcatcagatatc
gatgagacagacgttgcagataataaaacggagtctgtcgagagctacgatgataggcaa
gtctga

DBGET integrated database retrieval system