KEGG   Haloquadratum walsbyi DSM 16790: HQ3648AHelp
Entry
HQ3648A           CDS       T00375                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HQ3648A (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ3648A (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HQ3648A (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HQ3648A (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HQ3648A (adh)
   00626 Naphthalene degradation
    HQ3648A (adh)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HQ3648A (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3023838..3024881
Genome map
AA seq 347 aa AA seqDB search
MDAARLHNYTDDMDSALSIDSIDRPTVERSDDIIVEVAGAGWCQTDNHIIEGMWTDYVDQ
DLPMTLGHENTGEVIAVGDEVQTIDVGDTIICHPVMTCGTCRQCRLGEDMYCENLSFPGL
TTDGGFAEYLRTSERSAIPLPDGVDPVDIAPHADAGITAYHAVKKAVDELNPGDPAIVIG
VGGLGHIGLQCLDAMSAADIIALDIKEAARDLAADLGARYTVDPTSEDVSAAIDDLTDGH
GAEQVIDFVGADVTTGYAPDVIAPGGDHHIVGYGGHIHEPSQALVDAEFAYRGTIVGQYT
ELQELVRLVERGDVELRTSRYDLGSVNAAAEQLEHGEIEGRAVITPN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagcaagactccataattatacagacgatatggatagtgcgctcagcatcgat
agtattgatcggccaactgtcgaacgatccgatgatattattgttgaagttgctggtgct
ggatggtgtcagacagataatcatattatcgaagggatgtggaccgactacgttgatcaa
gacctcccaatgacacttggacatgagaatactggtgaggtaattgctgttggcgatgaa
gtgcagactatcgatgtcggcgatacaataatttgtcatcccgtaatgacgtgtggcacc
tgccgacagtgtcgtcttggcgaagacatgtactgtgagaatctctcattccctggtctc
acgaccgatgggggattcgcagaatatctccgcacgagcgagcgatcggctataccactt
cctgatggtgttgatcctgttgatattgctccacacgccgatgctggaattactgcttac
cacgccgtgaagaaggctgtcgatgaattaaatccaggcgatccagccattgttattggt
gttggcggattggggcatatcggactacagtgtcttgatgcaatgagtgcagcagatatc
attgcacttgatataaaggaagcggctcgtgaccttgcggctgatcttggtgcacgatat
acagtcgatcccacaagtgaagatgtttcagcagcaattgacgatctcactgatggtcat
ggtgctgaacaggtgattgattttgttggcgctgatgtaacgacaggctatgctccggat
gtaatcgctcccggtggcgatcatcatattgtcgggtacggtggacatattcatgaacca
tcgcaggcacttgtcgacgcagaatttgcatatcgtggaacgattgtcggacagtatact
gaactgcaggaacttgtccgattggttgaacgtggcgatgttgaactgcgaacgagtcga
tatgaccttggctctgtcaatgctgctgctgaacaacttgaacatggtgaaattgaaggg
cgcgccgtaatcacgccaaattaa

DBGET integrated database retrieval system