KEGG   Haloquadratum walsbyi C23: Hqrw_1047Help
Entry
Hqrw_1047         CDS       T01942                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hqrw_1047 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hqrw_1047 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hqrw_1047 (thrC1)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hqrw_1047 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
45398..46663
Genome map
AA seq 421 aa AA seqDB search
MSLELSAAAPAIPPEATDGVWLADIETGETYAPFEEIRYTSDEDNLLEVRYADLPTFEDF
QGQGRGVWRYHAALPFENGVSLPEGDTPLHRAPSIRDAAGVRSLRIKHEGMNPTGSFKDR
GMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMQTLVLLPAGKVAAGKIAQAALH
DARILEVDGNFDDCLDIVQDLARRGEVYLLNSLNPFRLEGQKTIGLEILERFYEEYGRFP
DRIILPVGNAGNTSALYKAFRELVQSGALRPSEVPKLTGVQAAGAAPMVEAVEHGWSDIE
RWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVTDDEITVAQRDLAREGIGVEPAS
AASVAGLKKLRGRSRIDSDEDVVCLTTGHLLKDPDEAFKAGGNPEPVGGDTDAVLEHIGA
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaacttagcgccgccgctccagccatccccccggaggccaccgacggtgtc
tggctcgcggatatcgaaacgggagaaacatacgccccgttcgaggagatccgctatacg
agcgatgaggataatttacttgaggttcggtatgccgaccttccaacatttgaagatttc
cagggacagggtcgcggtgtctggcggtatcacgctgctcttccgtttgagaatggagtt
agccttcctgagggagatacaccacttcatcgagcacccagtattcgggatgcagccggt
gttcgctcattgcgtattaaacatgaagggatgaacccaactggatcattcaaggatcgt
ggtatgactgttggtgtccgagttgcgaaagaactcggcgttggacggctcgcttgtgca
tcaacggggaatacatctgccgcacttgccgcatacggtgcgcgcggtgggatgcaaacg
cttgtgttgttacccgctggaaaggttgcagccggaaagatcgctcaagccgcacttcat
gacgcccgtatcttagaagtcgatggcaactttgatgattgtctcgatatcgtccaggat
cttgctcggcgtggtgaagtgtatttgttgaactcattaaatccattccgacttgaggga
cagaaaacaatcgggcttgaaattctcgaacgattttacgaggagtatggtcgattccct
gatcgaattatccttccggttggtaatgccggtaatacttcagctttatataaagcgttc
cgcgagttggtccaatcgggagcactcagaccaagtgaagttccaaagctcacgggcgtc
caagcggcaggcgcagcaccaatggttgaagcggttgagcatggatggtcggatatcgag
cgctgggatgatgttgaaacccgagcaacagcaattcggattggaaatccagttaacgct
ccaaaggcgcttccagggattcgtgaaaccggcggcacagctattgcagtgactgatgat
gagattactgttgctcaacgtgatcttgcacgggagggtattggtgtcgagcccgcatcc
gcagcctctgttgctggattaaagaaactccgtggtcggagtcgaatcgacagtgatgaa
gacgttgtttgtcttaccaccggacatctgctaaaggaccccgatgaagcattcaaggct
ggcggtaatccagaacccgttggcggtgacactgacgctgtcttagagcatatcggcgcg
aattga

DBGET integrated database retrieval system