KEGG   Haloquadratum walsbyi C23: Hqrw_1194Help
Entry
Hqrw_1194         CDS       T01942                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hqrw_1194 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hqrw_1194 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hqrw_1194 (trpA)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hqrw_1194 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(217279..218127)
Genome map
AA seq 282 aa AA seqDB search
MEGQGLASAFSDGPAFVPYLAAGDPDYESGLAYVEALARGGADIIELGLPFSEPIAEGPT
IQSAIVRSLEAGMTPDQFFEFVTDLDVDPTEVPLVCMTYYNLIYQYGDEEGPRPFVKRAA
DVGLSGFVVPDLPAEESDPLRTACNEFGLDLVFIVAPTTKGDRLNTIMSQVSGYVYVQAR
LGVTGARDDVSTQTESSLSRLDAYDVPKAVGFGIKTGEHAERIVAGGADGIIVGSALVDI
VASGTEAGDSTTTVADRLETKARELTDGVQRGYQKRMPKPDT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaggacaggggcttgcatctgcattctctgacggtccagcattcgttccatatctt
gcagcaggtgacccagattatgaatctgggcttgcatatgtggaggcacttgcacgcggt
ggcgctgatatcattgaacttggacttccgttctcagagccgattgctgaaggaccaaca
atccagagtgctattgttcggtcgcttgaagcagggatgactccagatcagttttttgag
tttgtcaccgacctcgatgtcgatccaactgaggttccactcgtgtgcatgacgtattat
aatctcatctatcaatatggtgatgaggagggtccgcgaccgtttgttaaacgcgccgcg
gatgttggactctcaggatttgttgttccagatttgcccgctgaggaatcagatccgctc
cggacagcttgtaatgagtttgggcttgatcttgtatttattgtcgctccaacgacgaaa
ggcgaccgacttaatacgattatgtcacaggtatcaggatatgtctatgtgcaagcgcga
cttggtgtgactggtgcccgtgatgatgtctcgacacaaaccgagtcaagcctctcgcgg
cttgatgcatacgatgtcccgaaggcagtcggatttggaattaagaccggagagcatgcc
gaacggattgtcgctggtggtgctgatggcatcatcgttggaagtgcattggttgatatc
gttgcttcggggactgaagctggcgattcaacaacaacggttgctgaccgacttgaaaca
aaggctcgcgaacttacagatggggtccagcgagggtatcaaaaacggatgccaaagccg
gatacatga

DBGET integrated database retrieval system