KEGG   Haloquadratum walsbyi C23: Hqrw_1196Help
Entry
Hqrw_1196         CDS       T01942                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01130  Biosynthesis of antibiotics
hwc01230  Biosynthesis of amino acids
Module
hwc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hqrw_1196 (trpC)
Enzymes [BR:hwc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hqrw_1196 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE QRPTase_C His_biosynth DHO_dh NMO DUF1611_N
Motif
Other DBs
NCBI-ProteinID: CCC39163
UniProt: G0LGE3
Position
complement(219405..220220)
Genome map
AA seq 271 aa AA seqDB search
MDASEESLAPAVQSILTAAKQRAGGTSRCSVDATSFQSAISATEAAGQTPVIAEIKPTSP
TTDGKRDDDPVALASAMVEGGATALSVLTEPEHFGGSVETLAQIRNVVEVPILRKDFIVH
ESQLDAVAADMILLIARFLDRPETDSLKQLYNAAQNRGFQPLVEVHTRDELERAIEIGAS
IIGVNNRDLGRLAVTLQTFEQLAPHVPDDVTLIAESGIKTIEHVQQMRAAGADALLIGTA
IMNGDVQTNTRRFTTVTDTDIQDTTTETHTS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggacgctagtgaagaatctcttgcacctgcggtgcaatcaattcttacggctgcaaaa
cagcgtgctggtggcacatctcgatgtagcgtcgatgcaacatcgtttcagtcagctatc
tcagcaactgaggcagccggtcaaaccccagtcattgcagagattaagccaaccagtcca
acaactgatggaaagcgagatgatgacccggttgcacttgcatcagcaatggtcgagggt
ggtgcaactgcattatcagtattgacagagccagagcatttcggtgggtcggttgagact
cttgctcagatacgcaatgtggttgaggttccgattcttcggaaggacttcattgtgcat
gaatctcaacttgatgcggttgcggctgatatgattcttcttattgcgcggtttctcgat
agaccggagacagattcactaaagcagctgtataacgcagcacaaaatcgtggattccag
cccttggttgaggttcatacccgtgatgaacttgaacgtgcaattgaaattggtgccagc
attattggagtcaacaaccgtgatcttggtcgccttgcggttactcttcaaacctttgag
caactggcaccacacgtccctgatgatgtcacacttattgccgagagtggtatcaagaca
attgagcacgttcaacaaatgcgtgcggctggagccgatgcattgcttatcgggacggct
attatgaacggagacgtgcaaacaaatacaagacggtttacaaccgtaacagacacagac
atacaagacacaacaacggagacacatacatcatga

DBGET integrated database retrieval system