KEGG   Haloquadratum walsbyi C23: Hqrw_1417Help
Entry
Hqrw_1417         CDS       T01942                                 

Gene name
pimT
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hwc  Haloquadratum walsbyi C23
Brite
Enzymes [BR:hwc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hqrw_1417 (pimT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(442640..443479)
Genome map
AA seq 279 aa AA seqDB search
MDPAVLREDMVNSVETQLDVSVAAPVSHAMRTVPREPFVEDAPYQNSSSEHIGTTILAPS
VVARLLTALHISTEPDINVQLNSPESTENPESADKSIAKGESTHETASDDVLVVGAGVGY
TAAVLAELTDERHVHAIDINRQVVHTARSNLEVAGYEGVLVDTRDGAHGLPEYAPFNRIL
VEAASLEPPKALLNQLTANGRLVIPLGGPSQTIATVDAQGNILTEQGAVALDPLLVEGES
GDGPARNRTVREDAEFDESGYFAPTGWEQEWIDWDKNQH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcggtactccgtgaagatatggtcaacagcgttgaaacacagcttgatgtc
agcgtcgctgcgcctgtttctcatgcaatgcgcactgttccgcgggaaccatttgttgaa
gatgcgccctatcagaatagttcctctgagcatatcggaacgacaattctcgccccaagc
gtcgttgcacgattgcttactgcactgcacatctcaacagaaccagatatcaatgtccag
ttgaattcacctgagtccacggaaaatcctgagagtgcagacaagagtatagccaagggt
gagagtacacatgaaacagcctcagatgatgtgcttgttgttggtgctggtgttggatat
actgcagcagtgctcgctgagcttaccgatgagcggcatgttcacgcaatcgatattaat
cgccaagttgtccatacagcacggtcaaatcttgaagtagctggatatgagggtgttctt
gttgatacgcgcgatggtgcacatggattacctgagtatgcgccatttaaccgaattctc
gttgaagccgcatcgctcgaaccaccgaaagcacttctcaatcaactcacagccaatggg
cgattggtcattccattgggaggaccatcgcaaacaattgcaactgttgatgcacagggg
aacatacttactgaacagggtgcagtcgcactagatccactgttggttgaaggtgaaagc
ggtgatggtccagcgcggaaccgaacggtccgtgaagacgctgaattcgatgagagtgga
tattttgcaccaactgggtgggagcaggagtggattgattgggataaaaaccaacattaa

DBGET integrated database retrieval system