KEGG   Haloquadratum walsbyi C23: Hqrw_1421Help
Entry
Hqrw_1421         CDS       T01942                                 

Gene name
gap1
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating) (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_1421 (gap1)
   01230 Biosynthesis of amino acids
    Hqrw_1421 (gap1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_1421 (gap1)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Hqrw_1421 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
445639..446712
Genome map
AA seq 357 aa AA seqDB search
MIRVGVNGYGTIGKRVADAVALQPDMEVVGVAKTKPNFEAHTADQRGYEMYAAIPDRAPL
FGDAGVELAGAVDELVAAADIMIDCTPSGIGAENKSLYESYDTPAIFQGGEDATIAEVSF
NARANYAAACGTDSVRVVSCNTTGLSRVIAPLQEAYGIEQVRTTLVRRGGDPSQNSRGPI
NDILPNPISIPSHHGPDVKTIFPDLAIDTLGLKVPATLMHVHALNVTLKSDVTVAHVRQL
LEEESRIYVISEGMGIDGAGKLKDFAHDAGRPRGDIWENCVWGESIAISGRDLYFFQAIH
QESDVIPENIDAIRAMTESATAAESIELTNRTLGVGITGSPVGVVDTDHSGVEAADD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagtgggtgtcaacggctatgggacaatcggcaaacgtgtcgccgacgctgtt
gcgttgcaacccgatatggaagtcgtcggcgtcgcaaagacaaagccgaattttgaggcc
cacaccgctgatcaacgcggttatgagatgtatgctgcaatcccagaccgcgctccatta
tttggggatgctggcgttgaacttgccggtgcggttgatgaattggttgcggctgctgat
atcatgattgactgtacaccatctggaattggtgcggagaataaatcactgtatgaatca
tacgacacccccgccatttttcagggtggtgaagatgcaacgattgctgaggtgagcttc
aacgctcgggcgaattatgctgctgcctgtgggactgatagcgttcgagttgtttcatgt
aacactactggattatcacgggttattgctccacttcaggaagcttatgggatcgaacag
gttcgaacgacactcgttcgacgtggtggtgatcccagtcaaaattcccgtggtccgatt
aatgacattctgccaaatccaatctcaattccctcacatcatggtccggatgttaagacg
atttttcctgatcttgcaattgatacgcttggattaaaagttccagcaacactgatgcac
gtgcatgcactcaatgtaacgctcaagtctgatgtaactgtagcacacgttcgacagttg
cttgaagaagaatctcgaatctatgttattagtgagggaatggggattgacggcgctgga
aaactcaaggattttgcacacgacgctgggcgtccacggggagacatctgggaaaactgc
gtttggggtgaatcaattgctatctcaggtcgtgacttgtatttcttccaagcaatccat
caggaatcagatgttattccagagaatattgatgcgattcgagcaatgaccgaatcagca
acagccgctgaaagtattgaattaacaaaccgaacacttggcgttgggattaccgggtca
ccagtaggagtcgttgatactgatcactctggagttgaggctgcagatgactga

DBGET integrated database retrieval system