KEGG   Haloquadratum walsbyi C23: Hqrw_1467Help
Entry
Hqrw_1467         CDS       T01942                                 

Gene name
gap2
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD) (phosphorylating) (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_1467 (gap2)
   01230 Biosynthesis of amino acids
    Hqrw_1467 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_1467 (gap2)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Hqrw_1467 (gap2)
Exosome [BR:hwc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Hqrw_1467 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486439..487494
Genome map
AA seq 351 aa AA seqDB search
MSEKSNLSANPSTNPIRVGLNGFGRIGRSVLRAIITNPSIELVGINDVMEFDDMGYLAKY
DTVMGRADDISQDGNMLSVGETTVPLYNIQDPTELPWGQLEVDVTLECTGIFRTRSDAAA
HLEAGADKVIISAPPKGDEPVKQIVYGVNHHEYTGEDILSNASCTTNSVSPVAKVLDDEF
EIESGLLTTVHAYTGSQALIDSPMTKTRRGRAAAENIIPTSTGAAQATTEILPQLDGKLD
GMAMRVPVPNGSITELVVNLSTAPSVEVVNDAFRNAADDGPLAGVLGYTDDEVVSSDIIG
LPFSSMVDLNSTNQVNAGGLYKILTWYDNEFGFSNRMLDLAQFVTNTSTNT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaatcgaatttatctgctaatccaagcacaaatccgattcgggttggattg
aacggatttggtcggattgggcgaagcgttctccgggcaattattactaatccatcaatt
gagcttgtcggaataaacgatgtgatggaattcgatgatatgggttatttagcgaagtat
gatacagttatgggtcgggctgatgatatctcacaggatgggaacatgctcagcgttggc
gagacaaccgtaccactgtataatatccaagatccgacggaattgccatggggtcaactt
gaggtagacgtcacacttgagtgtacgggtatttttcgaacccggtcagacgccgcggca
catctagaagcaggggcagataaggtgattatctctgcaccgccgaagggtgatgagcca
gtcaagcaaattgtgtatggtgtcaatcatcacgaatataccggtgaggatattctctca
aatgcatcttgtacgaccaactccgttagtccagtcgcgaaagtcctcgatgatgaattc
gaaatcgaaagtggtcttttgaccactgtccacgcatacactggaagtcaagcacttatc
gatagtcctatgacaaagacgcgacggggacgggcagctgcagagaatattattccaacc
tcaacaggagccgcacaagcgaccacagagatacttccgcaacttgatggtaaactcgat
ggaatggcaatgcgtgttccagtcccgaacgggtcaattacagagttggtggttaatcta
tcgactgcgccaagtgttgaagtcgtaaatgatgcattccgcaatgctgctgatgatggc
ccacttgctggtgtactgggctatactgatgatgaggtggtctcatcagatatcattgga
cttccattctcctcgatggtcgatcttaattcgaccaatcaggtaaatgcaggaggactt
tataagattctcacgtggtatgataacgaattcggcttttcaaaccggatgcttgatctt
gcacaattcgtcacgaatacgagtacaaatacatag

DBGET integrated database retrieval system