KEGG   Haloquadratum walsbyi C23: Hqrw_1639Help
Entry
Hqrw_1639         CDS       T01942                                 

Gene name
acs1
Definition
acyl-CoA synthetase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_1639 (acs1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_1639 (acs1)
   00620 Pyruvate metabolism
    Hqrw_1639 (acs1)
   00640 Propanoate metabolism
    Hqrw_1639 (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hqrw_1639 (acs1)
   00680 Methane metabolism
    Hqrw_1639 (acs1)
Enzymes [BR:hwc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hqrw_1639 (acs1)
Lipid biosynthesis proteins [BR:hwc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hqrw_1639 (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677422..679401
Genome map
AA seq 659 aa AA seqDB search
MTDDDVELEARLAEQESFDPPASFVDQANVTDEAIYDEFSENWPECWTRAADLLSWDSEY
STVLDDSDEPFYEWFADGNLNAAYNCVDRHVEDGNKNRVAIKWEGEHGNTRTYTYQDLYR
EVNEFAATLQELGVKENDVVTMYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATRM
NSADSEYLITADGYYRRGDALDHFQKAQEGLDNVEHDVAASVVVDRLGDDGFGHELSETQ
YDWDSLMDAHRGDRVAPVERNAEDMLFLMYTSGTTGEPKGVKHTTGGYLAYTAWTAQSVL
DLEPGDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDYPERDRLWDIIEKYAVDV
FYTAPTAIRAFMKWGTEYPDSHDLSSLRLLGTVGEPINPRAWKWYYTHIGDESCPIVDTW
WQTETGGMMVTTLPGIGTMKPGSAGPPSPGIDATIVDTAGEDVDAGRAGYLTVNKPWPGM
LRTLYQNDERFIDEYWEEYSDPDTDEWVYFPEDGAKIDDDGYITILGRVDDVLNVSGHRL
GTMEIESAIVGVNGVAEAAVVGGDHDLKGEAVYAYVITEDGYAEDEDLRESIIKGVEDGI
GPIARPEQVIFTEELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEIVDEIEAKVSGD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacgatgtcgaactcgaggcacgccttgctgagcaggaaagctttgatccg
ccggcgtcgtttgtcgatcaggcaaacgtcacagacgaggccatttatgatgagttctct
gaaaattggcctgagtgttggactcgcgcggctgatctgctttcttgggacagtgaatac
tcgactgttcttgatgactcagatgagccgttctacgaatggttcgctgatggtaatctg
aacgccgcatataattgcgttgaccggcatgtcgaagacggcaataaaaaccgggttgca
atcaagtgggaaggtgaacacggtaacactcgcacgtatacatatcaagatctgtatcgt
gaagtaaatgaatttgctgccacactgcaggaacttggggtgaaagaaaacgatgttgtc
acgatgtatatgccaatgattcctgagcttccgattgcaatgcttgcatgtgcacgcatc
ggtgccccacactcagttgtgtttgctggattctccgcagatgcgcttgcaacgcggatg
aattctgccgactctgaatatctcatcaccgccgatgggtattatcgacgcggtgatgca
cttgatcacttccagaaagcacaagaaggacttgataatgtcgagcacgatgtcgccgca
agcgttgttgtggaccgtcttggcgatgacggattcggtcatgaactgagtgaaacgcag
tatgactgggactcactcatggatgcacaccgcggtgaccgagttgcacccgttgagcga
aacgctgaggatatgctgtttttgatgtacacttctggtacaactggcgaaccaaaaggt
gttaaacacacaactggcggttatcttgcttacaccgcctggacagcacaatcagtgtta
gatcttgaacctggtgacacctactggtgctcagctgacattggctggattaccggacat
tcatatattgtttacggtccactcgcattgggcacgacaacggtcatgtatgagggaaca
ccggattaccccgagcgggatcgactctgggatattattgaaaaatacgccgttgatgtg
ttctatacggctccaacagcaatccgagccttcatgaagtggggtacggaatatcctgac
tctcatgatttatcgagtcttcggctgcttggaactgttggcgaaccgattaatccacgc
gcatggaagtggtattatacccacatcggtgatgagtcttgcccgattgtcgatacatgg
tggcagacagaaacaggcggaatgatggttacgactctcccgggcattgggacaatgaaa
ccaggttctgccggtccaccctcgccaggaatcgatgcgacaattgttgataccgccggt
gaggacgtcgatgcaggtcgggcaggatatcttacggtgaataaaccatggccggggatg
cttcgaacgctgtatcagaatgatgaacggttcattgatgaatactgggaggagtattcc
gacccagataccgatgaatgggtatatttcccggaagatggcgccaagatcgacgatgac
ggctatataacaatattggggcgggttgatgatgtactcaatgtatcaggacatcggctc
ggaaccatggagattgagtcagcaatcgtcggtgtgaatggtgttgcagaagcagcagtc
gttggcggtgatcatgatctgaaaggtgaggctgtatatgcatatgtcatcactgaagac
ggatatgctgaagatgaggacctaagagaatcaatcatcaaaggcgttgaagatggaatc
ggtccgattgcacgaccagaacaagttatatttaccgaggagctgccaaagacgcgatca
ggcaaaattatgcgacgccttcttgaggagattgcaaacggtgaagaattgggagacaca
acaacactcagaaacccagaaattgttgacgaaatcgaggcaaaagtcagtggcgattga

DBGET integrated database retrieval system