KEGG   Haloquadratum walsbyi C23: Hqrw_1669Help
Entry
Hqrw_1669         CDS       T01942                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00260  Glycine, serine and threonine metabolism
hwc00750  Vitamin B6 metabolism
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01120  Microbial metabolism in diverse environments
hwc01230  Biosynthesis of amino acids
Module
hwc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hqrw_1669 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hqrw_1669 (thrC2)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hqrw_1669 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCC39607
UniProt: G0LGQ5
Position
complement(707941..709155)
Genome map
AA seq 404 aa AA seqDB search
MKTSESFRGLYCTASGDQHDLTATGPTDTGGRLEPMYDTSGIKWGMDTSAFERGSDADTD
NDIDITTRSMWRYNELLPFIDPITAGEGNTPLVTAPQLAAEVGVETLAIKDESRNPTGTI
LDRGLSSAVTAARETGADLLALATPGNAGQSAAAYAGIAGLRSYAFVPSRTPFSNKAMVN
VHGSEMRVAGGRYPDAEDALAEQLQSDWYTLQEFNNPYRHDGIKTVAFELAEAHGWDVPD
AVVVPAGTGEVVAGVAKGFRELTAADILSSMPTLYAAQPSGCAPIVDAATEGAVEVEPWD
NPDTIVGELEIPDPNGGTAALEAIDECDGEIIAVDDDAILEAAVVAAQHAGLEIGAAGGA
AIAAVDKLADRGVFDPTDTVIAVNTESGTKTADVLRSHLMGKGI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatctgagtcgtttcgtgggttatactgtaccgcgagcggggatcaacacgat
ttgacggcaactggtccgactgacactgggggtcggctcgagccaatgtatgatacaagc
ggcatcaagtggggaatggatacaagcgcgtttgagcgcgggagtgatgctgatactgat
aatgacatcgacattacgacacgttcgatgtggcgatataatgaattacttccgttcatc
gacccaattaccgctggtgagggtaatactccacttgttacagctccgcaacttgctgca
gaggtaggtgttgagacacttgcaattaaggatgagagtcgaaacccaactggaacgata
cttgaccgtgggctgtcatcagctgtcaccgccgctcgcgagacaggtgctgatttgctt
gcacttgcgacacctggaaacgctggacagtcagcagctgcatatgctggaatagccgga
cttcgttcatatgcatttgtcccatcaagaaccccgttctcgaacaaagcaatggtgaat
gttcatggaagtgaaatgcgagtcgctggcggaagatatcccgatgcagaggacgcactc
gccgaacagcttcagtcagattggtatacactacaagaattcaataacccatatcgtcat
gatggaatcaaaacagttgcatttgagcttgcggaagcacacggatgggatgtgcctgat
gctgttgttgtccctgccgggactggagaggttgttgctggtgttgcgaaaggatttcgc
gagcttactgccgcggatatactcagttcaatgccaacgttgtacgccgctcaaccatct
ggatgcgcaccgattgttgatgctgcaaccgaaggtgctgtggaagtcgaaccgtgggat
aatccagacacaatcgttggtgaattagaaattccggacccaaacggtggaactgcagcc
cttgaggcgattgatgagtgtgatggagagattatcgctgttgacgatgatgcaatttta
gaagcagcagttgttgccgctcagcatgctgggcttgagattggagccgctggaggggcc
gctattgctgctgttgataaactcgctgatcgtggtgtctttgacccgacggacactgtc
attgctgtcaacactgagtcagggacaaaaaccgctgatgtgttgcgaagtcatctgatg
ggtaagggtatatag

DBGET integrated database retrieval system