KEGG   Haloquadratum walsbyi C23: Hqrw_1899Help
Entry
Hqrw_1899         CDS       T01942                                 

Gene name
folCP
Definition
folylpolyglutamate synthase / dihydropteroate synthase (EC:2.5.1.15 6.3.2.17)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hqrw_1899 (folCP)
Enzymes [BR:hwc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Hqrw_1899 (folCP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966070..968580)
Genome map
AA seq 836 aa AA seqDB search
MDYHEAADVLTGLQQRRPKLGVETTARMLAHLDNPHASIDCVQIAGSNGKGSTARMLEQI
LDDAGLRVGLFTSPGLNDFREQIRVEGRTIAKKHVSKYVERLVPCLETLRADNDEPTHFE
ALTAVSLAHFAAMDVDIAILEVGIGGRYDATSAVDPIASAVTSVSLEHTELLGETVDVIA
RDKAQVAPSEAPLITGTTGDALAAIREETDVITVGNDSDSEADIIATETGISSPIESAVS
IVGSEWAVETHLPLVGAHQATNAGVAATLARQVQDVSIDTIETGLRGATWPGRFELMSHS
PRVVLDGSHNPGATATLGSLLERYEYDELHVVFAAMQDKDHEAMIQSLPSITTAYATEPA
VERAETAETLAPILQMNAKTVETIQSVPEATEEAIETAGARSDDLVLVTGSLYAVAEARD
RWTRLLVPVNRSSSIDIGVGKESDNAVSERVNPGYAEAMFETDKADVTTQCFRTTLRPAQ
VEIFADHVAAGGGFCHQTTVGSPQKLTAIVFGGTTRDLMTLSDSLVDAGHGLRHVGSQLQ
RQLTETTPVSVSGLNDTRTAVMGILNITPDSFYDGGEYNSVDAAMDQANTMIDAGVDILD
VGGESTRPGAEPVPISEEIDRIVPVIEALSNLEVPISIDTRKAAVADAALSAGADIVNDV
SGFDDPEMPFVVAEHDAELVLMHSLSAPVDPDRRATYDDVVTDVMNELTEQLLRAERAGI
QRDQIIVDPGCGFGKSPAESFELVDRIDEFEALGCPVLVGHSRKSMLATMNQPDDERLSA
TIAVTTLAADRGADVVRVHDAGENAAAVRAAAAAKHPYRAEDDTTEIDAETEADDR
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggactatcatgaggctgccgacgtgcttactggactccaacagcgtcggccgaaactc
ggggttgagacgaccgcgcggatgcttgcacaccttgacaatccccatgcctcaatcgac
tgcgtacagattgctggatcgaatgggaaagggagcaccgcgcgtatgcttgaacaaatt
cttgatgatgccggtcttcgagtcggattattcacgtcgcccggattaaacgattttcgc
gagcaaatccgcgtggaaggacgaacaatcgcaaagaagcatgtgagtaaatatgttgag
cgacttgtcccgtgtctcgaaacacttcgggctgataatgatgagccgacacattttgag
gcactaactgctgtttcgcttgcacatttcgcggcgatggatgttgatatcgccattctt
gaagttggtatcggtggtcgatatgatgcaacaagtgctgtcgacccgattgcaagtgct
gtgacaagtgttagtcttgaacatacagagctactgggtgagactgtcgatgtcattgca
cgtgataaggcgcaggttgccccaagcgaagcccctctgattactggaacaacaggcgat
gcacttgctgctatccgtgaggaaacggatgtgattacagtcgggaatgatagtgactct
gaggctgatattattgcgacggagacaggtatatcctcaccaatcgagagcgctgtttca
atcgttgggtctgagtgggcggtcgaaacacatctaccacttgttggagctcatcaagca
accaacgcaggggttgctgcaacgcttgcccggcaggtgcaagatgtctcgattgatact
atcgaaactggattgcgtggggcaacgtggccagggcgatttgaattgatgtcacacagc
ccacgcgttgtgcttgatggttcgcataatcctggagcaacggcaacacttggatcatta
ctcgaacgatacgagtatgatgagttacacgtcgtcttcgcagcgatgcaagacaaagat
catgaggcgatgatacaatcactgccttcaattacgactgcatacgcaacagaaccagct
gtcgagcgcgctgaaacagcagagacgttggcgcctattcttcaaatgaatgcaaaaacg
gtcgagactatccaatcagttcccgaggcaacagaggaagcaatcgaaacggctggagct
agatcggatgatctcgtgctagtaacaggatcactatatgctgttgcagaggctcgtgat
agatggacacgattgcttgtccctgtcaatcgctcatcgagtatcgatattggcgttggg
aaagagagtgataatgctgtaagcgagcgagtaaacccagggtacgcagaagcaatgttt
gagacggataaagccgacgtaaccacacagtgctttcgaacaacgcttcgtccagcacaa
gtcgaaatattcgccgatcatgttgctgctggtggtggtttctgtcatcaaacaacagtt
ggcagtccacagaagctcacggcgattgtctttggtggaacaacaagggatttgatgaca
ttatccgactcgctcgttgacgctgggcacggactgcgtcatgttggatcacagttacag
cggcagctcactgaaacaacacctgtctctgtctctgggcttaacgatacacgaactgcg
gtgatgggaattttgaatattacaccagatagcttctatgatggtggtgaatacaattca
gtcgatgcagccatggatcaggctaatacgatgattgatgccggtgtcgatattcttgat
gttgggggtgaaagtactcgacctggagcagagcccgtacctatttctgaggaaattgat
cggattgtgccagtaatcgaagcgttatcgaatttagaggtgccaatatccattgatacg
cggaaagcagcagttgctgatgctgcgctgtccgcaggcgctgatatcgttaatgatgtc
tctggattcgatgatcctgagatgccattcgttgttgccgagcatgatgctgaattggtg
ctcatgcatagtctttcagcaccagtcgatcctgaccggcgtgcaacgtatgatgatgtc
gtcacagatgttatgaatgaactcactgagcagttacttcgtgccgagcgagcaggcatt
caacgtgatcagattattgttgacccaggatgtgggtttgggaaatcaccggcggagtcg
tttgagctggttgaccgaattgatgagtttgaagcgcttggatgtcccgtgctagttgga
cattcacggaaatcaatgcttgcaacgatgaaccagccggatgatgaacgactctcagca
acgattgcagtgaccacactcgcagcagaccgcggagccgatgtcgtgcgggtacatgat
gctggcgagaatgcggctgcagttcgggcagcagctgccgcaaaacatccatatcgggct
gaagatgatacaacagagatagacgcagaaacagaggcagatgacagatga

DBGET integrated database retrieval system