KEGG   Haloquadratum walsbyi C23: Hqrw_1934Help
Entry
Hqrw_1934         CDS       T01942                                 

Gene name
elp3
Definition
homolog to elongator complex protein ELP3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hwc  Haloquadratum walsbyi C23
Brite
Enzymes [BR:hwc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Hqrw_1934 (elp3)
Transfer RNA biogenesis [BR:hwc03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Hqrw_1934 (elp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999365..1001074
Genome map
AA seq 569 aa AA seqDB search
MSTETDTDDTGSEPDPTETEAFRSTCKHLVEQIVAGDVDRDSLESAKLDACSQYGSPKVP
KNTDILSHASAANRDDVKSVVRRKPVRTASGVSPIAIMTSPHMCPHGKCLYCPGGPASEF
DSAQSYTGHEPAAARGKQNEYDPYGQVTLRLEQLRHIGHPVDKVELIIMGGTMTSRSHDY
QEWFLKRALEAMNDYDTDSKPDPASDQSFKPDPEDVEFRYLEDVIAENETADIRNIGTTF
ETKPDWCDPEQIDRMLDLGATKVEVGVQTTYERINREMHRGHGVQASIDANQRLRDAGFK
VGFHMMPGQPGMTSKMIREDFRQLFNRTEYRPDYLKIYPTLVVRGTRVYDQWRRDDFEPL
DNETAAEIIAEVMGMIPEYTRLQRVQRDIPADFIDAGVWKSNLRQLASQRADEKGIEIRD
IRAREAGLNETDPDPEHIELNEMTYDVAGGTEHFLKFEDSYADLLIGFCRLRFPGATVRR
ELKNAAVVRELHVYGSEAGIGATANKSESTGDTAWQHKGYGKRLITRAEELAREAGYDSL
AIISGIGARQYYRQKLGYHQDGPYVAKKL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactgaaacagacacagacgacacgggatcagagcctgacccaacggagacggaa
gcattccgcagcacctgtaagcatcttgtcgagcaaatcgtcgcaggtgatgtcgaccgc
gatagtctcgagtcggcaaaactagatgcttgttcacaatatgggtcaccaaaggttcca
aaaaacacagatatcctttcacatgcctccgcggcgaatcgcgatgatgtcaaatccgtt
gtgcggcggaagcctgtccggaccgcatcaggtgtctcaccaattgcgataatgacttct
ccgcacatgtgtccgcatggtaaatgcctatattgtccaggcggtcctgcaagtgagttt
gattccgcacagagttacactggacatgaacctgctgcagcacgtggcaagcagaatgaa
tacgacccatatggtcaggtaacactccgacttgagcaacttcgacacatcggacacccg
gttgataaagtcgaactcattattatggggggaacaatgacttcacggagtcatgattat
caagagtggttcctcaaacgtgcgcttgaagcgatgaatgattatgatactgattcaaaa
ccggatcctgcatctgatcaatcatttaaacctgatccggaagatgttgaatttcggtat
cttgaagacgtcattgcggagaatgagactgcagatattcggaatatcgggacaaccttt
gaaacaaaaccggactggtgtgacccagaacagatcgaccggatgcttgaccttggtgcg
acaaaagtcgaggttggcgtgcagacaacctatgagcggattaatcgcgaaatgcatcga
ggacatggtgtgcaagcatcaatcgatgcaaaccaacgactccgcgatgccggattcaaa
gttggcttccatatgatgcctggacaaccaggaatgacgtctaagatgatccgcgaagac
ttccgacaactgttcaatcgcaccgaatatcgtcctgattatctgaagatctacccaaca
cttgttgtacgcggaactcgcgtatatgatcaatggcggcgcgatgattttgaaccactt
gataatgaaacagccgcagaaataatcgcagaggtaatggggatgattccagaatatacg
cgccttcagcgtgttcaacgtgatatccctgcagatttcattgatgctggtgtatggaag
tctaacctgagacaattagccagtcaacgtgctgatgagaagggaattgagattcgtgat
attagggcacgtgaggcaggattgaatgaaactgaccctgatcctgagcatattgaattg
aatgaaatgacatatgatgtagctggcgggaccgaacacttcctcaagtttgaagattcg
tatgcagatctgctcattggattctgccgacttcgattcccaggagcaacagttcgtcgc
gaacttaaaaacgctgctgtggtccgagaactacatgtatatggaagtgaggcaggaatt
ggggcaacagctaataaatccgaatctactggagatactgcttggcaacataaggggtat
ggaaaacggcttattactcgtgctgaggagctggcacgtgaggctgggtatgattcactt
gcaattatctcgggaatcggtgctcgacagtactatcggcagaaacttgggtatcatcag
gacggaccgtacgttgcaaagaaattatga

DBGET integrated database retrieval system