KEGG   Haloquadratum walsbyi C23: Hqrw_1986Help
Entry
Hqrw_1986         CDS       T01942                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hwc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hwc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1053503..1054462)
Genome map
AA seq 319 aa AA seqDB search
MSERRSTEHESESEDTDRESDISVTETTKQTLSQTSESTQTSVPRSAIDQARHIAATADR
VVVKAGTNSLTDSTSNLDDEKLDKLVDDIADLIEHDKEVILVSSGAIGAGKGRAGYAADD
TVEESQALSTIGQSHLMRRYTESFERYGLTVAQILITDHDLEDMERFTNFKNTIETLLSW
DVIPIINENDAVATEEIRIGDNDMLSSSLAIGVESDLLVILTDVGGVYTGNPKENTNATR
INAVGANYDEVESIIAVSSESKFGGIQTKVRGARAVSEHGIPAIIARSTESDVLQRIATE
ISVGTIFVPVDNQTKTDSD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacgacggagcactgagcatgagtctgaatctgaggacactgaccgcgaatca
gatatttcggtcaccgaaacaacaaagcagacattgtcacagacctccgaatccacgcaa
acatctgttccacgatcagcaattgatcaagcacgtcatatcgctgcaacagcagaccgt
gtcgttgtcaaagctggaacgaattctctgacagattcaacgtcaaatcttgacgatgag
aaactcgataaactcgttgatgatatcgctgatcttatcgagcatgataaggaggttatt
cttgtctcctcaggggcaattggcgctggaaaaggacgggcagggtatgccgcggacgac
accgtcgaagaatcacaggcattgtcaacgattggacagagtcatctcatgcgtcgatat
actgagagttttgagcggtatggattgactgttgcacagatcctcatcaccgatcatgat
ctcgaagatatggagcgattcactaatttcaagaacactattgaaacgcttctctcctgg
gacgttatcccaattatcaatgaaaacgatgcggtcgcaacagaagaaatccgtattggt
gataatgatatgctttcgtcatcgcttgcaatcggcgttgaaagtgatcttctcgtgata
ctgactgatgttggtggtgtctatactggaaatccaaaagagaatactaacgcaacacgc
attaatgctgtcggtgccaactatgacgaggttgaatcaatcattgcagtcagttccgaa
agcaaatttggtgggattcagacgaaagtgcgaggtgctcgtgcagtgagtgagcatggc
attccagcgattattgctcgctcgacggagtctgatgtgctacaacggattgcaacagaa
atctcagttggaacgatctttgttccagttgataatcaaacaaagactgatagtgattag

DBGET integrated database retrieval system