KEGG   Haloquadratum walsbyi C23: Hqrw_2019Help
Entry
Hqrw_2019         CDS       T01942                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hwc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hwc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1089867..1090781)
Genome map
AA seq 304 aa AA seqDB search
MHQDHLLSTTQLSREDIETILDRAAAIEMNPDGWEAQYSGTVLGLCFFEPSTRTRMSFDA
AMKRLGGRTIDMGSVDNSSISKGETLADTVRVIAGYADAIVLRHPSEGAAKLAAEFVDIP
VINAGDGAGQHPTQTLLDLYTMRENVGLDEITVGIAGDLKYGRTVHSLAAALSNFDVRQH
FISPESLQLPRNIRYDLHDSGSQVREHTDIESILPELDVLYVTRIQRERFPDENEYQRVA
GQYRVDTDILSHADDNLTVMHPLPRVDEIAPEVDTTEHAAYFEQAHNGVPVRMALLDALI
GRAK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggaccacttactctccacaacacaattatcacgggaggatatcgagaccatt
cttgaccgggcggcggcgattgaaatgaatccagatgggtgggaggcgcaatatagtggg
acggtacttggattatgtttttttgagccaagcactcgaacgcgtatgagtttcgatgct
gcaatgaaacgactcggtggacgcacaatcgatatgggtagcgtcgacaactcatcaata
tcgaagggcgagacactcgctgatacggttcgtgtcattgccggatacgctgacgccatc
gtgttgcgacatccatctgaaggggcagcgaagctagctgctgaattcgttgatattcct
gtcatcaacgccggtgacggtgccggacagcatccgacacaaacactcttagatttgtat
acaatgcgagagaatgtcggactcgatgaaatcaccgttggaatcgctggtgatttaaaa
tatggtcgcacggttcactcacttgccgcagcattgagtaattttgatgttcgacagcat
ttcatcagccctgaaagtcttcagctccctcgaaatatacgatatgatcttcatgactcc
ggctcacaggtgcgtgaacatacagatattgagtcaatacttcccgaacttgatgtctta
tatgtcacacgaattcagcgtgagcggttcccagatgaaaatgaatatcaaagagtcgct
ggacaatatcgtgtcgatactgatattttatcacatgcagacgataatttgaccgtgatg
cacccgctcccgcgagttgatgaaatcgcgccagaggtggatacgaccgaacatgcggcg
tatttcgagcaagcacacaatggggtaccggttcgaatggcgctgcttgatgcattgatt
gggagggcaaaatga

DBGET integrated database retrieval system