KEGG   Haloquadratum walsbyi C23: Hqrw_2223Help
Entry
Hqrw_2223         CDS       T01942                                 

Gene name
pucL1
Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hwc00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1281808..1282737
Genome map
AA seq 309 aa AA seqDB search
MNYGKENVSVYRTYATPLKGVRTIPESTFDGRENILFGADIRMQVEGEDFLPSFSDGDNS
MVVATDSMKNFIYHHMGEYDGATLEGLLEYIGSEILDTYSQMEAVTMSADQLPFDKTEVP
DDGEFTPSELVFGVSDSPSGYAELRIDETNAGITITEHTSGVTGIELVKVKDNSFTGYVQ
DEYTTLPERENRTLYVGLDIFWTYDNAETALGSDPEAYVPAEQVSDIVQVVFDDMDVNSI
QELIYQIGQRILKRFSQLNSVRFEANNRTWIGVRDDDLDDDGKVLREPPAPTGFQQFSMD
RSDLERSEK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgggaaagagaacgtctcagtctaccgaacgtatgcaacaccactgaaaggt
gtgcgcacaataccggaatctacgtttgacggtcgagagaatattctatttggggcagat
atccgaatgcaggtagaaggcgaggactttctgccatcattcagtgacggtgacaacagc
atggtagtggcaactgactcgatgaagaacttcatctatcatcatatgggcgagtatgac
ggtgcgactctcgaggggttgcttgaatacattgggtcagaaatacttgatacatactca
cagatggaggctgtgaccatgtcagccgaccaactcccattcgataaaacggaggttcca
gatgacggagagttcactccaagtgagttggtatttggcgtttcagatagtccatcaggc
tatgctgaactccgtattgatgaaacaaatgccggaataacaattactgaacatacaagc
ggtgtcaccggaatcgaactggtgaaggtcaaagataattcattcactggatatgttcaa
gacgagtatacaacgctaccagaacgagaaaaccgcacattgtatgttggtctcgatatt
ttctggacatacgacaacgcggagaccgcccttggttcggatcctgaagcatacgtccca
gccgagcaggtgagtgatatcgttcaagttgtctttgatgacatggatgtcaactcgatt
caagaactgatctatcaaattggacaacgaatcctcaaacggttctcccagctcaattca
gtgcgctttgaggccaacaatcggacgtggattggtgtgcgtgatgatgatcttgatgac
gatggtaaggtgctccgagaaccacccgctccaaccgggtttcaacagttctcgatggat
cgaagtgatcttgagaggagcgaaaaatga

DBGET integrated database retrieval system