KEGG   Haloquadratum walsbyi C23: Hqrw_2539Help
Entry
Hqrw_2539         CDS       T01942                                 

Gene name
chlID
Definition
(GenBank) ATP-dependent cobaltochelatase subunit ChlID
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00860  Porphyrin and chlorophyll metabolism
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hqrw_2539 (chlID)
Enzymes [BR:hwc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Hqrw_2539 (chlID)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 MCM AAA_16 Sigma54_activat VWA_3 AAA_29
Motif
Other DBs
NCBI-ProteinID: CCC40381
UniProt: G0LKU1
Position
complement(1551266..1553554)
Genome map
AA seq 762 aa AA seqDB search
MANSKKTSTPVAFADIVGQDELKNALISVVVNDSLDGLLIQGEKGTAKSTAVRALQTILP
EQRVVAECSYGCPPDAPSMQCADCQERMNPSVELRPVPLITLPLGATRERVVGSLSVEAA
LEGESEFDPGLLAAANRGLLYVDEVNLLDDHLVDIILDAAASGENRVERDGVSVTHPASF
TLIGTMNPEEGDLRPQLKDRFALQATVSGLEEIPDRVDVIEQVLEDDQDADDSTDQTNIH
LSNSSTETNSHTAVHERIVRARELLPSVTLPSSFTTDIAELCRDAGVDGHRADIATARAA
ITFAALAGRTTVIEGDVRRAAELALPHRLQSTPFEDAPDPEDVLDEHFDDEGDGTDNTAD
DADADTQKSDDDDGDGTDGNNSQVDRSQSEQSSNDDSNRSTEQGANNDDANIPEHREDRA
DIDETQDGSNRPPPQSGDSGSDESTSADNDDIDDDESHPNGESGDNQNGGDSDDESDTEQ
ITPRVPGQPSTETAVDPDQSVTRAPDINIDSQNERQNQSNDASNGGSQSGKMDTTNRGAR
VRTERAAPTDSDVDAGASIRAAASRGADQVTSRDLRQSVRAGETSALVIFAVDASASMRK
PMRTAKGVAIELLKDAYQQRDEVALVAFAGDNADVMLPPTDNVSLAARHLKELPTGDQTP
LTAGIETTTEVLSRADPDTGIVVLVTDGRANAVGERPTAAVRSAARTLAAHNPHVVVVDA
GSRSRATVTDTIVSVTNGERIPLSALTAERVDAAVSTAQSNR
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacagtaaaaaaacttcgacgccagtcgcattcgccgacattgtcggacaggat
gaattaaagaatgcgctcatatcggttgtcgtcaacgattcacttgatggattactcatt
cagggtgagaaaggaacagcaaaatcaacagctgtgcgggcactacagacgatattaccc
gaacagcgtgtcgttgctgagtgttcatatggatgtccacctgatgcgccgtcgatgcag
tgtgcggactgtcaagagcgaatgaacccatccgtcgagctccgtccagttccactcata
acacttccactcggggcaactcgggagcgagttgtcgggagtctctcggttgaggctgcg
cttgagggtgagtctgaattcgatccagggttacttgcagctgccaatcgtggcttattg
tatgttgatgaggtaaatcttcttgatgatcatcttgtagatataatacttgatgctgct
gcaagcggtgagaatcgggttgaacgtgatggagtcagcgttactcatccggcttcattt
acccttatcgggacgatgaatcccgaagagggtgacctccgaccacagttgaaggatcga
ttcgcgttacaagcaactgtcagcggacttgaagagattcccgaccgggtcgatgtaatc
gagcaggtacttgaggatgatcaagacgctgatgattcaacagatcaaactaacatacat
ctatctaatagttctacagagacaaacagtcacaccgctgttcatgagcgaatcgttcgt
gctcgcgagttgcttccatcagttacgcttccatcgtcgttcacaaccgatattgcagag
ctctgtcgtgacgctggtgttgacggtcatcgcgctgatatcgcaacagctcgcgctgca
atcacgtttgctgcacttgcaggacggacgacagtcatcgagggggatgtccgccgagca
gctgagcttgcacttccacatcgactacagtcaacaccatttgaagatgcaccggatcca
gaggatgttctcgatgaacacttcgacgacgaaggagatggcaccgataatacggcagat
gatgcggatgcagatacacaaaagagtgatgatgacgatggtgacggtactgacggaaat
aattctcaagttgatcgctcacaatcagagcagtcatcaaatgatgacagcaacaggagt
actgagcagggtgcaaataatgatgacgcgaatattcctgaacatcgtgaggatagagca
gatatcgatgaaacacaagatgggtccaatagaccgccaccacaatcaggtgattcggga
tcggatgagagcacatctgcggataatgatgacatagatgatgatgaatcccatcctaat
ggtgaatctggggataatcaaaatggtggtgatagtgatgatgaatccgatactgaacag
ataacgccacgagttcctggacagccatctactgagacggcagtagatccggatcaatcg
gtgacacgagctcctgatatcaatattgattcgcaaaatgaacgacagaatcaatcaaat
gatgcgtcgaatggtgggtcgcagtcgggaaaaatggatacaacaaaccgtggtgcccgt
gttcggaccgaacgagcagcaccaacagattctgatgttgatgctggtgcctcgattcga
gcggctgcctcacggggagcagatcaagtaacgtctcgggaccttcgacagtcggttcgt
gcaggcgaaacatcagcactagtgatttttgctgttgatgcgagtgcttcaatgcgtaag
ccgatgcggacagcaaaaggcgtcgcaattgaactgctgaaggatgcatatcaacaacgt
gatgaagtagcactcgttgcatttgcaggcgataatgctgacgtcatgcttccaccaaca
gataatgtaagcttagccgcacgccatctcaaagagttgccgaccggtgatcaaacacca
ctcaccgcgggaatcgagacaacaacagaagtgctctcacgtgcagaccctgataccggg
attgtcgtacttgtcactgatggtcgtgcgaacgctgttggagagcgaccgacagctgca
gttcgttcagccgcgaggactctcgcagcacataatccacacgtcgttgtcgttgatgcc
gggtcacgctcgagagccacagtcactgatacgattgtttcggtaacgaatggtgagcgg
attccactgtcggcactaacagctgaacgcgttgatgcagcggtttctactgcacagagc
aatagataa

DBGET integrated database retrieval system