KEGG   Haloquadratum walsbyi C23: Hqrw_2571Help
Entry
Hqrw_2571         CDS       T01942                                 

Gene name
ligB1
Definition
DNA ligase (ATP) (EC:6.5.1.1)
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Hqrw_2571 (ligB1)
   03410 Base excision repair
    Hqrw_2571 (ligB1)
   03420 Nucleotide excision repair
    Hqrw_2571 (ligB1)
   03430 Mismatch repair
    Hqrw_2571 (ligB1)
Enzymes [BR:hwc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hqrw_2571 (ligB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1583177..1585033)
Genome map
AA seq 618 aa AA seqDB search
MKYSELAEVYTDVAATSATTQKGTLLADCFLDVYNNTEKSLLPVTVRLVQGRVFARWEAA
EIGVSTAGAADAISKATGVESEQIETWWREEGDLGDAAAYAVDDRVQQTLTATPLTVTRV
YETLREVASYAGSGSQQKQRDEIAGLISDASPLAARYIVRTVTGSMRLGVGEGIVRNALA
SAFLDMSDDAADAVQRAIDLTNDVAVVAQRVAEQGQPGLDDVDLELFRPIKPMLAKQAES
IQTAVDELAADPKHIERNHNIELSHSGAVLIEFKYDGIRAKIHRDGDEIRVYTRRLSDVT
EQFPDVVSAARDHIDAEHYIIEAELVGYDPQSNDDTPVTFQTLAQRIQRTDNVATIAKSI
PVTTYVFDLLALNGESLLTDTLEMRLERLNTILSTKATSDSKSASTHNAHSSTSVTTVSN
DQYQSSSSLRRAQCTWATTQTTATEFYEDALAAGHEGVMIKNPTRPYQPGSRVGYQRKIK
PTMEPLDLVVTRAKWSEGRKSDFLGRPYLACRTADGNLAEVGRMHTGFTDDQLETFTNRV
EPLIEHVEGREATLTPAVVLAVEYEEIQISSTYDSGYALRFPRLKQIRHDCDPSQADSLE
RVERLYEQQSLDESQTSV
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtactctgaactcgctgaggtatatactgacgtcgctgcgacatcagcaacgacc
cagaaggggacgctcctcgctgattgtttcttagatgtctataataataccgagaaatcg
ttgcttccggttaccgttcgacttgtccagggtcgtgtattcgctcgctgggaagcagcg
gaaattggtgtttcaaccgctggtgctgcagacgcgattagtaaggcaaccggtgtcgag
agcgaacagatcgagacatggtggcgagaggagggtgatcttggtgatgctgctgcatac
gctgttgatgatcgcgtacaacagacactcactgcaacaccgctgacagtcacccgtgta
tatgagacactccgcgaggttgctagttatgcaggttcgggtagtcaacaaaaacagcga
gacgaaattgctggactcatctctgatgcatcaccactcgctgctcgatatatcgttcga
accgtaacaggatcaatgcgacttggtgttggtgaaggaatcgttcgtaatgcacttgca
agcgcattccttgacatgtctgatgatgctgcggatgccgtccagcgagcgattgactta
accaacgatgttgctgttgtcgcgcagcgtgttgctgagcaggggcaacccgggttagat
gatgttgatcttgagttatttcgtccaattaagccaatgctcgcaaagcaagcagagagt
attcagactgcggttgatgaacttgccgcagatccgaagcacattgagagaaatcataat
atagagttatcacacagtggagcagtcctcattgagttcaaatatgatggtattcgtgct
aagatacaccgcgatggtgatgaaatacgagtatatacacgacgactttctgatgtgaca
gagcagttcccggatgttgtctcagcagcacgtgatcatattgatgctgagcattatatt
attgaggcagagcttgttggatacgacccacaaagtaacgatgataccccagtcacattc
caaacgcttgcacagcgtatccaacgaaccgataacgtcgccacgattgcgaagtcgatt
ccggtcacaacatatgtctttgatttacttgccctcaatggtgaatcattgctaacggat
acgcttgagatgcggttagaacgcctcaatacaatccttagcacaaaggcgacgtcagat
agtaaatccgcctcgacacataatgctcactcttcaacgtctgttacgaccgtgagtaat
gatcaatatcaatccagctcatcactgagacgggcacagtgtacgtgggcaacaacacag
acaacagcaacggagttctatgaggatgcacttgctgctggtcatgagggtgtgatgata
aaaaatccgacgcgaccgtatcaacccgggtctcgagttggatatcagcggaaaataaag
ccaacaatggagccactcgatctggttgttacccgggcaaagtggagtgaggggcgtaaa
agtgactttctcggtcgaccgtaccttgcatgccgaactgctgatggtaatctcgcagag
gttggtcggatgcataccggattcactgatgatcaacttgagacgttcacaaaccgtgtc
gaaccattgattgaacatgttgaagggagagaagcaacgctcacacctgctgttgtgctc
gcggttgaatatgaggaaatacagatctcatcaacatatgattctgggtatgcacttcga
tttccacgattgaaacaaatccgacatgactgtgacccatcgcaggcagactcacttgag
cgcgttgagcggttgtatgaacaacaatcactcgatgagagtcaaacgagtgtataa

DBGET integrated database retrieval system