KEGG   Haloquadratum walsbyi C23: Hqrw_3251Help
Entry
Hqrw_3251         CDS       T01942                                 

Gene name
sucC
Definition
succinate--CoA ligase (ADP-forming) beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hwc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hwc00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hwc00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:hwc00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263128..2264273)
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKELFADAGIPVPDSQRATSSDEVLTAVEDIGYPAAIKAQVHVGGRGKAGGIK
IASNKQEAKAYAEEILGMEIKGYTVNSVLVEAGVDFENELYIGITMDRSSGKPVAMVSTE
GGVDIESVAAETPDAIAREHIDPVFGLHPYQARRAVYDAGVPSDVASDVAHILSTLYTQY
ESADASEIEINPVMITTDRDVVAADAVMNIDEDALFRQPELASMEDTAAGDDLEIKADEY
GFDYVRLDGDVGIIGNGAGLVMTTLDLVDYYGGSPANFLDIGGGAKAERVANALDMVFTD
DNVDAIVFNIFGGITRGDEVATGINEALEKFDTIPKDVVVRLAGTNAEEGMEILNTDRVE
VEATLEDAVEQAVINAQEVHQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttacacgaataccaggcaaaagaactctttgccgatgccggaatcccggtgcct
gactcacaacgtgcaacatcatctgatgaggttttgacagcagtcgaagacattggatac
ccagcagcaattaaagcacaagtgcatgttggtggtcgcggaaaagccggcggcattaaa
attgcgagtaacaagcaggaggcgaaagcgtacgccgaagagattcttgggatggagatt
aagggctatacagtcaatagcgttcttgtcgaagctggtgttgattttgaaaatgaatta
tacatcggcattacgatggatcgcagcagtggcaaacccgttgcgatggtctcaactgaa
ggtggggtagatattgagtcggttgctgcggagacaccagatgcaatcgcccgcgaacat
attgatcctgtatttggtcttcatccgtatcaggctcgacgtgctgtctatgatgccggt
gtccccagtgatgttgcctcagatgtcgctcacatcctttcaacattgtatacacaatat
gaatccgcagatgcgtctgagatcgagattaatccagtcatgatcacaactgaccgagac
gtggttgcggctgatgcagtaatgaatattgatgaagatgcgctcttcagacaaccggaa
cttgccagcatggaggataccgccgccggtgatgatcttgaaataaaagcagacgaatat
ggatttgactatgtccgacttgatggggatgttggaatcatcggaaatggggctggactt
gtcatgacgacgcttgacttggttgactattatggcggatctccggcaaacttccttgat
attggtggtggtgcaaaggctgaacgcgttgcaaatgcgcttgatatggtgtttaccgat
gataatgtggatgctattgtgttcaacatttttggaggaatcacacggggtgacgaagtt
gcaacaggtatcaatgaagcacttgaaaagttcgatacaattccaaaagatgtcgtcgtc
cgactcgctggaacaaacgctgaagaaggtatggagattctgaatactgaccgtgttgag
gttgaggcgacactcgaagatgcggttgaacaagcagtgatcaatgcacaggaggttcat
caatga

DBGET integrated database retrieval system