KEGG   Haloquadratum walsbyi C23: Hqrw_3251Help
Entry
Hqrw_3251         CDS       T01942                                 

Gene name
sucC
Definition
(GenBank) succinate--CoA ligase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_3251 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hqrw_3251 (sucC)
   00640 Propanoate metabolism
    Hqrw_3251 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Hqrw_3251 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hqrw_3251 (sucC)
Enzymes [BR:hwc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hqrw_3251 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2263128..2264273)
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKELFADAGIPVPDSQRATSSDEVLTAVEDIGYPAAIKAQVHVGGRGKAGGIK
IASNKQEAKAYAEEILGMEIKGYTVNSVLVEAGVDFENELYIGITMDRSSGKPVAMVSTE
GGVDIESVAAETPDAIAREHIDPVFGLHPYQARRAVYDAGVPSDVASDVAHILSTLYTQY
ESADASEIEINPVMITTDRDVVAADAVMNIDEDALFRQPELASMEDTAAGDDLEIKADEY
GFDYVRLDGDVGIIGNGAGLVMTTLDLVDYYGGSPANFLDIGGGAKAERVANALDMVFTD
DNVDAIVFNIFGGITRGDEVATGINEALEKFDTIPKDVVVRLAGTNAEEGMEILNTDRVE
VEATLEDAVEQAVINAQEVHQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttacacgaataccaggcaaaagaactctttgccgatgccggaatcccggtgcct
gactcacaacgtgcaacatcatctgatgaggttttgacagcagtcgaagacattggatac
ccagcagcaattaaagcacaagtgcatgttggtggtcgcggaaaagccggcggcattaaa
attgcgagtaacaagcaggaggcgaaagcgtacgccgaagagattcttgggatggagatt
aagggctatacagtcaatagcgttcttgtcgaagctggtgttgattttgaaaatgaatta
tacatcggcattacgatggatcgcagcagtggcaaacccgttgcgatggtctcaactgaa
ggtggggtagatattgagtcggttgctgcggagacaccagatgcaatcgcccgcgaacat
attgatcctgtatttggtcttcatccgtatcaggctcgacgtgctgtctatgatgccggt
gtccccagtgatgttgcctcagatgtcgctcacatcctttcaacattgtatacacaatat
gaatccgcagatgcgtctgagatcgagattaatccagtcatgatcacaactgaccgagac
gtggttgcggctgatgcagtaatgaatattgatgaagatgcgctcttcagacaaccggaa
cttgccagcatggaggataccgccgccggtgatgatcttgaaataaaagcagacgaatat
ggatttgactatgtccgacttgatggggatgttggaatcatcggaaatggggctggactt
gtcatgacgacgcttgacttggttgactattatggcggatctccggcaaacttccttgat
attggtggtggtgcaaaggctgaacgcgttgcaaatgcgcttgatatggtgtttaccgat
gataatgtggatgctattgtgttcaacatttttggaggaatcacacggggtgacgaagtt
gcaacaggtatcaatgaagcacttgaaaagttcgatacaattccaaaagatgtcgtcgtc
cgactcgctggaacaaacgctgaagaaggtatggagattctgaatactgaccgtgttgag
gttgaggcgacactcgaagatgcggttgaacaagcagtgatcaatgcacaggaggttcat
caatga

DBGET integrated database retrieval system