KEGG   Haloquadratum walsbyi C23: Hqrw_3510Help
Entry
Hqrw_3510         CDS       T01942                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (membrane anchor protein) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_3510 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hqrw_3510 (sdhD)
   00650 Butanoate metabolism
    Hqrw_3510 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Hqrw_3510 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2490715..2491086)
Genome map
AA seq 123 aa AA seqDB search
MAEHYSSFKRGGRRWLWQRITAAFLVVVLAFHFFLLHFVHHADEVTFAMSQGRMQELTYF
SLMILFLVTATFHGVNGVYNALINQGLSGTRRKATKVVLGVASIVLIVQGVRTAIAWAGG
IPI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacactactcttcattcaaacgcggcggtcgtcgatggctgtggcagcgcatc
acggcggcattcctcgtggtggtattagcatttcatttcttcttacttcactttgtccac
catgctgatgaggttaccttcgcgatgtcacaggggcgaatgcaggaattgacgtatttc
tcgttgatgatcctctttcttgtcactgcaacattccatggcgtcaacggcgtttataat
gcgctgattaaccagggcctctcaggcacccggcgaaaagcaacaaaggtcgttcttggc
gtagccagtatcgtcttgattgtacagggcgtccgaaccgcaattgcgtgggctggcggg
ataccaatctaa

DBGET integrated database retrieval system