KEGG   Haloquadratum walsbyi C23: Hqrw_3642Help
Entry
Hqrw_3642         CDS       T01942                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_3642 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_3642 (glcK)
   00052 Galactose metabolism
    Hqrw_3642 (glcK)
   00500 Starch and sucrose metabolism
    Hqrw_3642 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Hqrw_3642 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hqrw_3642 (glcK)
   00524 Butirosin and neomycin biosynthesis
    Hqrw_3642 (glcK)
Enzymes [BR:hwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hqrw_3642 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620541..2621509)
Genome map
AA seq 322 aa AA seqDB search
MSYYVGVDLGATNVRAVVAGEDGSVYGRSDDTTPGGPTGIAVTEAVLGVVREACADATIA
PDSVSAAGIGAIGPLDLAAGAVENPANLPDTIDQIPLTGPLSVLLDTKQVFLHNDTNAGV
IGERFYADRNPDDMVYLTISSGIGAGVCVDGSVLTGWDGNAGEIGHMTVDPQGRLTCGCG
HDGHWEAYCSGNSIPRYAKQLYETNPIETAIPIDDPALSAVDIFQYAPDDEFASYVLDRL
AHWNAMGVANIVHAYAPLVIYVGGAVALNNPAAVLQPIRNQMDEMVMSNVPEIKLTTLGD
EVVVRGALASALTAGTGDRSQM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactacgtgggcgttgatcttggcgcgaccaacgtccgtgcggttgtcgccggt
gaggacggatcggtatacggtcgcagcgatgacacgacgccgggtggaccaacaggtatt
gcagttacagaagcagttctcggtgttgttcgcgaagcgtgtgccgatgcaactattgcc
cctgattcagtttcagcggctggaatcggtgcaatcggtccacttgatcttgccgccggc
gctgttgaaaatcctgcaaatcttccggacacaattgatcagattccacttacaggtcca
ttatcagtgttactcgatacgaaacaggtatttcttcataacgatacaaacgcaggggta
attggtgaacgcttctatgctgatcgaaatccagatgacatggtatatctcacgatttca
tcagggatcggagcgggggtgtgtgtcgatggaagtgttctcacggggtgggacgggaac
gcgggcgaaattggacatatgaccgttgacccacagggtcgattaacctgtggttgcgga
cacgatggtcactgggaagcatactgttcgggaaatagtattcctcgatatgcaaagcaa
ttgtatgaaacaaatccgattgagacagccattccaattgatgatccagcgctctccgcg
gttgatatctttcaatatgcacctgatgatgaattcgcatcgtatgtgcttgaccgactc
gcacactggaatgcaatgggcgttgcaaatattgttcacgcatacgcaccattagttatc
tatgttggcggtgccgttgcattaaataatcctgctgcagtgttgcaaccaatccgtaat
caaatggatgaaatggtgatgtcaaatgtgccagaaataaagctcacaacacttggggat
gaagtcgttgttcgtggcgcactcgcgagtgcattaactgctggcaccggggatcggtcc
cagatgtga

DBGET integrated database retrieval system