KEGG   Haloquadratum walsbyi C23: Hqrw_3642Help
Entry
Hqrw_3642         CDS       T01942                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00010  Glycolysis / Gluconeogenesis
hwc00052  Galactose metabolism
hwc00500  Starch and sucrose metabolism
hwc00520  Amino sugar and nucleotide sugar metabolism
hwc00521  Streptomycin biosynthesis
hwc01100  Metabolic pathways
hwc01110  Biosynthesis of secondary metabolites
hwc01120  Microbial metabolism in diverse environments
hwc01130  Biosynthesis of antibiotics
hwc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_3642 (glcK)
   00052 Galactose metabolism
    Hqrw_3642 (glcK)
   00500 Starch and sucrose metabolism
    Hqrw_3642 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Hqrw_3642 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hqrw_3642 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hqrw_3642 (glcK)
Enzymes [BR:hwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hqrw_3642 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCC41385
UniProt: G0LMR5
Position
complement(2620541..2621509)
Genome map
AA seq 322 aa AA seqDB search
MSYYVGVDLGATNVRAVVAGEDGSVYGRSDDTTPGGPTGIAVTEAVLGVVREACADATIA
PDSVSAAGIGAIGPLDLAAGAVENPANLPDTIDQIPLTGPLSVLLDTKQVFLHNDTNAGV
IGERFYADRNPDDMVYLTISSGIGAGVCVDGSVLTGWDGNAGEIGHMTVDPQGRLTCGCG
HDGHWEAYCSGNSIPRYAKQLYETNPIETAIPIDDPALSAVDIFQYAPDDEFASYVLDRL
AHWNAMGVANIVHAYAPLVIYVGGAVALNNPAAVLQPIRNQMDEMVMSNVPEIKLTTLGD
EVVVRGALASALTAGTGDRSQM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactacgtgggcgttgatcttggcgcgaccaacgtccgtgcggttgtcgccggt
gaggacggatcggtatacggtcgcagcgatgacacgacgccgggtggaccaacaggtatt
gcagttacagaagcagttctcggtgttgttcgcgaagcgtgtgccgatgcaactattgcc
cctgattcagtttcagcggctggaatcggtgcaatcggtccacttgatcttgccgccggc
gctgttgaaaatcctgcaaatcttccggacacaattgatcagattccacttacaggtcca
ttatcagtgttactcgatacgaaacaggtatttcttcataacgatacaaacgcaggggta
attggtgaacgcttctatgctgatcgaaatccagatgacatggtatatctcacgatttca
tcagggatcggagcgggggtgtgtgtcgatggaagtgttctcacggggtgggacgggaac
gcgggcgaaattggacatatgaccgttgacccacagggtcgattaacctgtggttgcgga
cacgatggtcactgggaagcatactgttcgggaaatagtattcctcgatatgcaaagcaa
ttgtatgaaacaaatccgattgagacagccattccaattgatgatccagcgctctccgcg
gttgatatctttcaatatgcacctgatgatgaattcgcatcgtatgtgcttgaccgactc
gcacactggaatgcaatgggcgttgcaaatattgttcacgcatacgcaccattagttatc
tatgttggcggtgccgttgcattaaataatcctgctgcagtgttgcaaccaatccgtaat
caaatggatgaaatggtgatgtcaaatgtgccagaaataaagctcacaacacttggggat
gaagtcgttgttcgtggcgcactcgcgagtgcattaactgctggcaccggggatcggtcc
cagatgtga

DBGET integrated database retrieval system