KEGG   Haloquadratum walsbyi C23: Hqrw_3696Help
Entry
Hqrw_3696         CDS       T01942                                 

Gene name
cofE
Definition
(GenBank) coenzyme F420:L-glutamate ligase (EC:6.3.2.34 6.3.2.31)
  KO
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Hqrw_3696 (cofE)
Enzymes [BR:hwc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Hqrw_3696 (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Hqrw_3696 (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2674424..2675164
Genome map
AA seq 246 aa AA seqDB search
MELFAVSNLPEVNQGDDLAALITEQVDLRSDDIICVASTIVSKAEGRTANLDRFSPGPRA
RELTTALDSDIDPRFTQAVLEESVEVILESPFLLTETRFGHIGVNAGIDRSNVPDADLLL
LPKSPTESAQRLHEGLPANRIIVTDTCGRPFRHGQRGVALGWAGLPPARDWRGETDRDGR
ELSATVENVVDELAAASNLLTGEGDDGTPVVVIRDFEWGDHGSSDAHFRDVDTDFVRQAV
RGWSYA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaattgtttgcagttagtaatcttccagaggtgaatcagggcgatgacctcgcagcg
ttgattactgaacaggttgatctcagatcagacgatattatttgtgttgcttcaacgatt
gtttcaaaagctgagggacggactgcgaatctcgaccgtttttcaccgggtccacgtgct
agagaactcacaacggcgcttgattcagacatagatccgcgattcacccaggctgttctt
gaagagagtgttgaagttattcttgaatcaccattcctccttactgagacacggtttggt
cacatcggagtcaacgcagggattgatcggtcaaacgttcctgacgcagacttattatta
ctgccgaaatcgccgacagagagtgctcagcgtcttcatgagggattaccagctaatcgg
attatcgttaccgatacatgcgggcgaccgtttcgtcatggacagcgcggtgttgcactc
gggtgggcagggcttccaccagctcgtgattggcgcggggaaacagaccgagacggtcgt
gagctgagtgcaaccgtcgagaacgtcgttgacgagcttgctgctgcgtcaaatcttctc
acaggcgagggtgatgatggaacacctgtcgttgttattcgtgacttcgagtggggcgat
catggaagtagtgatgctcactttcgagatgtcgatacagactttgtgcgccaggctgtc
cgggggtggtcatatgcgtga

DBGET integrated database retrieval system