KEGG   Haloquadratum walsbyi C23: Hqrw_3730Help
Entry
Hqrw_3730         CDS       T01942                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_3730 (fdh)
  Energy metabolism
   00680 Methane metabolism
    Hqrw_3730 (fdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hqrw_3730 (fdh)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Hqrw_3730 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2714166..2715329
Genome map
AA seq 387 aa AA seqDB search
MSMEAVVYQGEKDVAIESVDEPEIEHPNDVIIDITTTCICGSDLHMYEGRTAADPGIVFG
HENMGIVTEVGDAVSGLEEGDRVVAPFNVACGFCENCEEGYTGFCTNVNPGFAGGAYGYV
AMGPYTGGQAEKLRIPYADFNALQLPDGDEHEDAFSLLADIFPTGWHGTELADIQPGDSI
AIYGAGPVGLMAAYSAKIKGAAEIYTVDRVPSRLELAEEHCDATAINFEEGNPVEQIKDI
HGGGVDKGVDAVGYQAVDPDKEGDSAYDPARENPAVVINNLIRTVKPTGQLGIPGLYVPE
DPGAPSEMAAQGRLGIDFGLLFEKGQALGTGQCNVKEYNRELRDLIIEGRADPSWVVSHR
VGLEEAPEMYERFDNREEGVTKVLLEP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggaagcagttgtatatcaaggcgagaaagacgttgcaattgagtcagtagat
gaaccagagatagaacacccgaacgacgtcattatcgacattacaacaacctgtatctgt
ggttcggatcttcatatgtacgaaggacggacagcagcggacccgggtattgtcttcggt
catgaaaatatgggaattgtcactgaggttggtgacgcagtctcaggacttgaagaagga
gatcgtgttgtcgctccattcaatgtagcttgtggattttgtgagaactgcgaagaagga
tataccgggttctgtacaaatgttaatcctggattcgcaggtggtgcatatggttatgtc
gcaatgggaccatatacgggaggacaggctgagaagcttcgaattccgtatgccgatttt
aatgcgcttcaactccccgatggcgatgaacatgaagatgctttctcgctcctagcagac
atcttcccaactggatggcacggtaccgaactcgcagatattcagcctggtgactccatt
gctatctatggtgccggtccggttggattgatggcagcatatagtgccaaaatcaagggt
gctgcagagatatataccgttgatcgtgtcccaagtcggcttgaactcgctgaagagcat
tgtgatgcgactgcaattaattttgaagaaggcaacccagttgagcaaataaaagatatt
catggtggaggcgttgacaagggtgtcgacgcagtcgggtatcaagcagttgacccagat
aaggagggagattctgcatatgatcctgcgcgtgagaatccagctgttgttatcaataat
ctcattagaactgttaaaccaacagggcaactcggtatcccaggactatatgttcctgag
gatccgggggcgccaagtgagatggctgcacagggacgactcggaatagactttggtctt
ctgttcgaaaaaggacaagcactggggacaggacaatgtaatgttaaagagtataaccgt
gaacttcgtgacctgatcatcgagggacgtgctgatcctagttgggttgtttcacatcga
gttggacttgaggaagcccctgaaatgtatgagcgattcgataatcgcgaagagggcgtg
acaaaggttctactcgaaccatag

DBGET integrated database retrieval system