KEGG   Haloquadratum walsbyi C23: Hqrw_3730Help
Entry
Hqrw_3730         CDS       T01942                                 

Gene name
fdh
Definition
(GenBank) formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00625  Chloroalkane and chloroalkene degradation
hwc00680  Methane metabolism
hwc01100  Metabolic pathways
hwc01120  Microbial metabolism in diverse environments
hwc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Hqrw_3730 (fdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hqrw_3730 (fdh)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Hqrw_3730 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCC41469
UniProt: G0LMZ9
Position
2714166..2715329
Genome map
AA seq 387 aa AA seqDB search
MSMEAVVYQGEKDVAIESVDEPEIEHPNDVIIDITTTCICGSDLHMYEGRTAADPGIVFG
HENMGIVTEVGDAVSGLEEGDRVVAPFNVACGFCENCEEGYTGFCTNVNPGFAGGAYGYV
AMGPYTGGQAEKLRIPYADFNALQLPDGDEHEDAFSLLADIFPTGWHGTELADIQPGDSI
AIYGAGPVGLMAAYSAKIKGAAEIYTVDRVPSRLELAEEHCDATAINFEEGNPVEQIKDI
HGGGVDKGVDAVGYQAVDPDKEGDSAYDPARENPAVVINNLIRTVKPTGQLGIPGLYVPE
DPGAPSEMAAQGRLGIDFGLLFEKGQALGTGQCNVKEYNRELRDLIIEGRADPSWVVSHR
VGLEEAPEMYERFDNREEGVTKVLLEP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggaagcagttgtatatcaaggcgagaaagacgttgcaattgagtcagtagat
gaaccagagatagaacacccgaacgacgtcattatcgacattacaacaacctgtatctgt
ggttcggatcttcatatgtacgaaggacggacagcagcggacccgggtattgtcttcggt
catgaaaatatgggaattgtcactgaggttggtgacgcagtctcaggacttgaagaagga
gatcgtgttgtcgctccattcaatgtagcttgtggattttgtgagaactgcgaagaagga
tataccgggttctgtacaaatgttaatcctggattcgcaggtggtgcatatggttatgtc
gcaatgggaccatatacgggaggacaggctgagaagcttcgaattccgtatgccgatttt
aatgcgcttcaactccccgatggcgatgaacatgaagatgctttctcgctcctagcagac
atcttcccaactggatggcacggtaccgaactcgcagatattcagcctggtgactccatt
gctatctatggtgccggtccggttggattgatggcagcatatagtgccaaaatcaagggt
gctgcagagatatataccgttgatcgtgtcccaagtcggcttgaactcgctgaagagcat
tgtgatgcgactgcaattaattttgaagaaggcaacccagttgagcaaataaaagatatt
catggtggaggcgttgacaagggtgtcgacgcagtcgggtatcaagcagttgacccagat
aaggagggagattctgcatatgatcctgcgcgtgagaatccagctgttgttatcaataat
ctcattagaactgttaaaccaacagggcaactcggtatcccaggactatatgttcctgag
gatccgggggcgccaagtgagatggctgcacagggacgactcggaatagactttggtctt
ctgttcgaaaaaggacaagcactggggacaggacaatgtaatgttaaagagtataaccgt
gaacttcgtgacctgatcatcgagggacgtgctgatcctagttgggttgtttcacatcga
gttggacttgaggaagcccctgaaatgtatgagcgattcgataatcgcgaagagggcgtg
acaaaggttctactcgaaccatag

DBGET integrated database retrieval system