KEGG   Haloquadratum walsbyi C23: Hqrw_3884Help
Entry
Hqrw_3884         CDS       T01942                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hqrw_3884 (tpiA)
   01230 Biosynthesis of amino acids
    Hqrw_3884 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hqrw_3884 (tpiA)
   00051 Fructose and mannose metabolism
    Hqrw_3884 (tpiA)
   00562 Inositol phosphate metabolism
    Hqrw_3884 (tpiA)
Enzymes [BR:hwc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hqrw_3884 (tpiA)
Exosome [BR:hwc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hqrw_3884 (tpiA)
  Exosomal proteins of bladder cancer cells
   Hqrw_3884 (tpiA)
  Exosomal proteins of melanoma cells
   Hqrw_3884 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2875253..2875897)
Genome map
AA seq 214 aa AA seqDB search
MFILINLKAYPCDPLEIANAARDVADDSGVRVAVSPQAADIARVSDTGVETWAQHVSPNN
YGSYTGSTLAEAVANAGATGTLINHSERRLTLADIDTAVNAASRVDLDTCVCANNPAQIG
AVTALSPDSVAVEPPALIGGDASVATADPDIVSNAVESTNSIDKTVDVYCGAGISAGNDV
IAARDLGASGILLASGVAKADNPRKALEDLVAPI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcttaatcaatctcaaggcatacccgtgtgacccactcgaaatcgcgaacgca
gctcgagatgttgctgatgattccggagttcgtgttgccgtatcaccacaggcagccgat
attgcgcgtgtctcggataccggtgtcgagacatgggcacagcatgttagcccaaataac
tacgggagttacactggtagtacacttgcggaggctgttgcaaacgccggagcaactgga
acactaatcaatcactccgagcggcgactcacacttgctgatattgatacagccgtcaac
gcagcatcgcgtgttgatcttgatacgtgcgtctgtgcgaacaacccagcacagattggg
gcagtgacagcacttagtccagacagcgtcgctgttgaaccaccagcgctcattggtgga
gatgcatccgttgcaacagctgatccggatattgtctccaatgctgttgagtcaacaaat
agtattgataaaacagttgatgtctactgtggagccggaatatctgctggtaatgatgtt
atcgctgctcgtgatctcggtgcaagtggtattctgcttgcatctggggttgcaaaggca
gataatcctcgaaaagcacttgaagacctcgtagctcccatataa

DBGET integrated database retrieval system