KEGG   Haloquadratum walsbyi C23: Hqrw_3974Help
Entry
Hqrw_3974         CDS       T01942                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hqrw_3974 (hemB)
Enzymes [BR:hwc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Hqrw_3974 (hemB)
Exosome [BR:hwc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hqrw_3974 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2965719..2966705
Genome map
AA seq 328 aa AA seqDB search
MNIELTDRPRRLRRDGIRSLVSETSVTAQDLVAPVFIDATTTTRTPIESMPGHERVPIED
AVTRVEEIRETGVEAVMVFGIPAEKDERGSRAWASDGVVQQAVRRITAETDAYVITDVCL
CEYTTHGHCGVVESDAATDPTLTVKNDKTLELLTKTAVSHVEAGAEMVAPSSMTDGMITA
IRTALDETGHTDIPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANSQEAKREV
RLDVEAGADVLMVKPALAYLDIVNTVSSNFDRPVAAYNVSGEYAMVHAAADRGWVDLEAT
AVESLIAMKRAGADLIITYFAEKLANQL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgagttgactgaccgcccacggcggctacgccgggacgggattcgatcactc
gtcagtgaaaccagcgtaactgctcaagatcttgttgcacccgtttttatcgatgcaacg
acaacaacacgaacaccaatcgagtcgatgccgggacacgagcgcgttccaattgaagat
gcggtgacacgcgttgaagagattcgtgaaaccggtgttgaggcggtcatggtatttgga
attccggctgaaaaagatgaacgcgggtcacgtgcatgggcaagtgatggtgttgtccag
caggctgtccgtcgcataacggctgagacagatgcgtacgtcattactgatgtttgcttg
tgcgagtatacaacacatggtcattgtggcgttgtcgaatctgatgcggcgacggaccca
acactgacagtaaaaaatgacaaaacacttgaattattgacaaagacggctgtttcgcat
gtcgaggcaggggcagaaatggtcgcaccaagttcaatgactgatggaatgataactgcg
atccgaactgcgttagatgagacaggacatacagatatcccaatcatgtcgtatgctgca
aagtacgaaagtgcattttatggtccattccgtgatgcagccgacggcgcaccggcattt
ggtgaccgacgacattaccaaatggatccagcgaacagtcaagaggcaaagcgggaggtt
cgacttgatgttgaagcgggggctgatgtgttaatggttaaaccggcacttgcatatctc
gatattgtcaacactgtatcgtcgaatttcgacagaccagtcgcagcatacaatgtgtct
ggagaatatgcgatggttcatgctgccgctgatcgcggatgggtcgatttggaagcgaca
gcagttgaatcacttattgcaatgaagcgagccggggctgatttgattattacatatttc
gctgaaaagcttgcaaatcaactctga

DBGET integrated database retrieval system