KEGG   Haloquadratum walsbyi C23: Hqrw_3981Help
Entry
Hqrw_3981         CDS       T01942                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hwc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2973137..2973991
Genome map
AA seq 284 aa AA seqDB search
MVNNKIDWRRSPQVGVFRPNDERMVTAVELLEEYGITPIPDPMLSVEPTGTIPEIDTVSD
ASPFVVLTSKTGVEILADAGWNPTVATLACIGPRTAAAARDAGWTVDIIPTEYSSQGLVD
ALADQVTDRSVIIARSDHGSETLIDGLDAAGAAVTETVLYELVRPDGTGQSTVMAAGNEL
DAVCFTSSLTVEHFLSAAANRELREEAIIGLNNAVVGTIGEPTRETAQAHGVRVDVTPAD
ATFEHLVEAVVNELQTRQLSSDTDETDVADNKTESVESYDDRQV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataacaagatagactggagacgatccccgcaggtcggcgtatttcggcctaat
gatgaacgtatggtcactgcggttgagctacttgaagagtatggaatcacacccattccg
gacccgatgttatcggttgagccgaccggcacaatccccgagatagacaccgtatcagac
gcatcgccatttgttgtgttgaccagtaaaactggtgttgagattctcgcagacgctggg
tggaatcccaccgtggcaacactggcatgcattggaccacggaccgccgctgcagcccgt
gatgctggatggactgtggatataatcccaacagaatattcctcgcaagggttagttgat
gcactcgcagatcaagtaacagaccggtcagttattatcgcacgaagcgatcacggaagt
gagacactcattgatggattagatgcagccggagcggctgtcacggagacggtcctttat
gaacttgtgcgacccgatgggaccggacaatcgacggtgatggctgctggtaatgaattg
gatgcagtttgttttacatcatcgctgacagttgaacactttctctcggctgccgcaaac
agagaactccgtgaagaagcgattataggccttaataatgctgttgttgggacaatcggg
gagccgactcgagaaacagcccaagcacatggagttcgggtcgatgtaacgccagcagat
gcaacattcgagcatcttgttgaggctgtcgtgaatgagcttcaaacaagacagttgtca
tcagataccgatgagacagacgttgcagataataaaacggagtctgtcgagagctacgat
gataggcaagtctga

DBGET integrated database retrieval system