KEGG   Haloquadratum walsbyi C23: Hqrw_4060Help
Entry
Hqrw_4060         CDS       T01942                                 

Gene name
adh2
Definition
(RefSeq) oxidoreductase (homolog to zinc-containing alcohol dehydrogenase) (EC:1.1.1.-)
  KO
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Propanoate metabolism
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3039820..3040863
Genome map
AA seq 347 aa AA seqDB search
MDAARLHSYTDDMGSALSIDSIDRPTVERSDDIIVEVAGAGWCQTDNHIIEGMWTDYVDQ
DLPMTLGHENTGEVIAVGDEVQTIGVGDTIICHPVMTCGTCRQCRLGEDMYCENLSFPGL
TTDGGFAEYLRTSERSAIPLPDGVDPVDIAPHADAGITAYHAVKKAVDELNPGDPAIVIG
VGGLGHIGLQCLDAMSAADIIALDIKEAARDLAADLGARYTVDPTSEDVSAAIDDLTDGH
GAEQVIDFVGADVTTGYAPDVIAPGGDHHIVGYGGHIHEPSQALVDAEFAYRGTIVGQYT
ELQELVRLVERGDVELRTSRYDLGSVNAAAEQLEHGEIEGRAVITPN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagcaagactccatagttatacagacgatatgggtagtgcgctcagcatcgat
agtattgatcggccaactgtcgaacgatccgatgatattattgttgaagttgctggtgct
ggatggtgtcagacagataatcatattatcgaagggatgtggaccgactacgttgatcaa
gacctcccaatgacacttggacatgagaatacgggtgaggtaattgctgttggcgatgaa
gtgcagactatcggcgtcggcgatacaataatttgtcatcccgtaatgacgtgtggcacc
tgccgacagtgtcgtcttggcgaagacatgtactgtgagaatctctcattccctggtctc
acgaccgatgggggattcgcagaatatctccgcacgagtgagcgatcggctataccactt
cctgatggtgttgatcctgttgatattgctccacacgccgatgctggaattactgcttac
cacgccgtgaagaaggctgtcgatgaattaaatccaggcgatccagccattgttattggt
gttggcggattggggcatatcggactacaatgtcttgatgcaatgagtgcagcagatatc
attgcacttgatataaaggaagcggctcgtgaccttgcggctgatcttggtgcacgatat
acagtcgatcccacaagtgaagatgtttcagcagcaattgacgatctcactgatggtcat
ggtgctgaacaggtgattgattttgttggcgctgatgtaacgacaggctatgctccggat
gtaatcgctcccggtggcgatcatcatattgtcgggtacggtggacatattcatgaacca
tcgcaggcacttgtcgacgcagaatttgcatatcgtggaacgattgtcggacagtatact
gaactgcaggaacttgtccgattggttgaacgtggcgatgttgaactgcgaacgagtcga
tatgaccttggctctgtcaatgctgctgctgaacaacttgaacatggtgaaattgaaggg
cgcgccgtaatcacgccaaattaa

DBGET integrated database retrieval system