KEGG   Halopiger xanaduensis: Halxa_0317Help
Entry
Halxa_0317        CDS       T01532                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hxa  Halopiger xanaduensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halxa_0317
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Halxa_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHALXA01:9692..10963
Genome map
AA seq 423 aa AA seqDB search
MKVGVIGAGMSGLTVVHALADRNVDVAAFEARDEPGGVMRSRHIDGRVVELGPQRLRLTP
GIESLVDELGLRDQLRKGDDDQPLYIYYDGKLRVVPLSVQEALTTDLLSPLGKLRILKEP
LTDSARPGETVDEFLVRKFGRQAARRYFGPLYSGLYGTDPQDMLVEYSLARAIENAGIDG
SILLWIIRRLFSGRETPPICTFDAGLGELPTRLYEEHADSISLETPVTEIRDRDDGFELV
TDDGSEIVDDVVVTTPSETAADLLEPVDSELSETLRRFNYNPIGVVFLESDFDGDGIGSL
VPTTEDVPISGLTWNASFLDRDGVFTCYVDPGRYPEMPDSTDEELGSVAAQAFERITGAS
ATPIHVHRWNPGMPAYDRSWTVMEDLEPPSGIHLCSNYVGRPGILGRLRNGKRLAGELAD
KAD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcggagtcatcggggccggtatgtctggcttgacggtcgtccatgcacttgcg
gaccgaaacgtggatgttgccgcgttcgaagcgagggacgagccagggggggttatgcgg
agccgccacatcgacggccgggtcgttgaactgggacctcagcggcttcgactcaccccc
ggtatcgaatcgctggtcgacgaactcggcctccgtgaccagcttcgcaagggtgatgac
gatcaaccgctgtacatctactacgacggaaagctccgcgtcgttccactctcggtccaa
gaggcactcacaactgatctgctgagtcccttaggcaaacttcgaatcctcaaggaaccg
ctcaccgactcggcccgtcccggcgagacggttgatgaattcctcgtccgaaagttcgga
cggcaggccgcccggcgctacttcggcccgctgtacagcgggctgtacgggacggatcca
caggacatgctggtggagtactcgctcgctcgggcgatcgagaacgccggtattgacggc
agtatcctcctgtggattattcgacgccttttctctggacgggaaacgccgccgatctgt
acattcgacgccggcctcggcgaactcccgacgcgactatacgaggaacacgccgattcg
atctcgctcgagactcccgtcacggagatccgggaccgcgacgacgggtttgaactcgtg
acggacgacggcagcgagatcgtcgacgacgtcgtcgtcacgacgccttcagagacggcc
gcagacctgctcgaaccggtggattcggagctttcggagacgctgcggcggttcaactac
aatcctatcggtgtcgtcttcctcgagtcggatttcgatggcgacggtatcggatcgctg
gtgccaacgacggaggacgttccgatcagcggcctgacgtggaacgcgagcttcctcgat
cgggacggcgtgttcacctgttacgtcgacccgggccgctatcccgagatgcctgacagc
accgacgaggagctgggatcggtcgcggcacaggcgttcgagcggatcaccggcgcatcg
gcaacgccgattcacgtccaccgctggaatccggggatgcccgcgtacgatcggtcgtgg
accgtgatggaggatctcgagccaccatcggggatccacctctgttcgaactacgtcggc
cggccgggaatcctgggtcgtctccgaaacggcaaacgactcgccggcgaactcgccgac
aaggccgactag

DBGET integrated database retrieval system