KEGG   Halopiger xanaduensis: Halxa_0469Help
Entry
Halxa_0469        CDS       T01532                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12111  evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00052  Galactose metabolism
hxa00511  Other glycan degradation
hxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Halxa_0469
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halxa_0469
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Halxa_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Fn3-like BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AEH39070
JGI: Halxa_0469
UniProt: F8DDH6
Position
pHALXA01:complement(198516..201641)
Genome map
AA seq 1041 aa AA seqDB search
MDDWIDPETISRNRLPPHVDVLPYPDRETALADDRTASRWFTSLNGRWQFDLAPTPSDAP
DGFADPAFDAADWDRIEVPLNWQVAGHGNPHYTNVVYPFPVDPPNVPTENPTASYRRTFY
VDDDWTERQVRLHFEGVDSAFHLWVNGEPVGYSEGARLPSEFDVSEYVHAGENTIAVRVY
KWSNGSYLEDQDMWWLSGIFRDTYAYAVPEIHVADIDARTELDDEYVDGVLRADVSVANG
GNANETVTVDAELRDPDGDSVVEFESTTAVDAGESETVTLEADVENPELWTAETPNCYDL
LLSVRDEQGSVTEVVAETVGFREVEIEDGIFRVNGEPVTIRGVNRHDFHPDRGRAVPLDA
MREDIELMKRHNINAVRTAHYPNDTRFYDLCDEYGLYVVDETDIECHGLEFAPETPHLSD
ASEWKATYVDRMIRMVERDKNHPSVVVWSLGNESDFGSNHVAMAEETRERDPTRPIHYEP
DEEQDVSDIVGPMYPPWDQLEAWAAEDEYEHPVILCEYAHAMGNGPGNLQEYWDLFYEHD
RLQGGFVWDWLDQGLRRTTDDGEEWFAYGGDFGDEPNDANFNINGLVFPDREPSPGLIEY
KKVIEPVALSAADLERGEVTVENGYDFRSLAHLRADWRVEADGRVVESGAFELPDVDPGE
SEIVSLPFDADEYDDEAEYLLTIDVSLAEDTRWASAGHTVATGQFELPTGGSPTEPSAEV
APLACEATDDGIVVSNVHFELVFDETAGAIDSMRYRGRELVTEGPTVGLWRAPTDNDRGL
PLSRTLLSRMTAAAAGDGQIDEGDVHTIGFAQLWREHGLDGLQFRADSVEYEVSGDERVE
ISVEGRLAPPIFDHGFAVEQEYTVADTGAVEIETELEPEGDLSGLPSLPRVGLDLTLPAA
FDRVSWYGRGPDESYVDSKRASLVGRYERDVDDLHTPYVRPQANGNRTDVRWAAITDQQG
VGLYVSGESPLNVTAHRYTRADLEAADHVHEVPRRDEVSVSLDAAHCGLGTGSCGPETLE
PYRVEPTTYEFTIELRPYVEE
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggacgattggatcgatccggagacgatcagccgtaaccggttgccgcctcacgtggac
gtattgccgtaccccgaccgagagaccgcccttgccgacgatcgaacggcgtctcggtgg
ttcacctcgttgaacggccgctggcagttcgacctcgcgcccacgccgtccgacgcgccg
gacgggttcgctgacccggcgtttgacgccgcggactgggatcgaatcgaggttccgctg
aactggcaagtcgccggacacgggaatccacactacacgaacgtcgtgtacccgttcccg
gtcgatccgccgaacgtccccacggagaatccgaccgcgtcgtaccgacggacgttctac
gtcgacgacgactggacggagaggcaggtccgcctccacttcgagggcgtcgactccgcg
ttccacctctgggtgaacggcgaacccgtcgggtacagcgaaggggcgcggctcccctcc
gagttcgacgtgagcgagtacgtccacgcgggggagaatacgatcgctgtccgcgtctac
aagtggtcgaacgggagctatctcgaggaccaggacatgtggtggctcagcggaatcttc
cgggatacgtacgcctacgcggtcccggagatccacgtcgcggatatcgacgcgagaacg
gaactcgacgacgagtacgtcgacggcgtcctccgggcggacgtcagtgttgctaacggc
ggcaacgcgaacgaaacggtcaccgtcgatgccgaactccgcgatccggacggcgactct
gtagtcgagttcgaatccacgacggcggtcgacgccggcgagagcgagacggtcacgctc
gaggcggacgtcgagaacccggagttgtggaccgcggagacgccgaactgctacgacctg
cttctctccgttcgagacgagcagggatcggttaccgaggtcgtcgcggagaccgtcggc
tttcgcgaggtcgagatcgaggacggcatattccgcgtaaatggcgaacccgtcacgatc
cgcggcgtaaaccgccacgatttccacccggatcgcggccgggcagtgcccctcgacgcg
atgcgggaagatatcgagctgatgaaacggcacaacatcaacgcggtccggaccgcgcac
tacccgaacgacactcggttctacgacctctgtgacgagtacgggctgtacgtcgtcgac
gagacggacatcgagtgccacgggctcgagttcgcgccggagacgccccaccttagcgac
gcgtccgagtggaaagccacctacgtcgaccggatgattcggatggtcgagcgggacaag
aaccatccgagcgtggtcgtctggtcgctcggaaacgaatccgacttcgggtcgaaccac
gtcgcgatggccgaggagacccgcgagcgcgatccgacgcggccgatccactacgagccg
gacgaggagcaggacgtgtcggacatcgtcgggccaatgtacccgccctgggatcagctc
gaggcgtgggcggccgaagacgagtacgagcacccggtcattctctgcgagtacgcccac
gcgatggggaacgggccggggaatcttcaggagtactgggatctattctacgaacacgat
cggttgcagggcggattcgtctgggactggctcgaccaggggttgcgccggacgaccgac
gacggcgaggagtggttcgcctacggcggcgacttcggcgacgagccgaacgacgccaac
ttcaacatcaacgggctcgtcttccccgaccgcgaaccctcgccgggattgatcgagtac
aagaaggtgatcgagccggtcgccctctcggccgcggacctcgagcgcggcgaggtgacc
gtcgagaacgggtacgacttccggtcgctggcgcacctgcgggccgattggcgcgtcgaa
gccgacgggcgagtcgtcgagagcggcgcgttcgaactccccgatgtcgaccctggtgag
agcgaaatcgttagcctcccgttcgacgcggacgagtacgacgacgaggccgagtatctg
ctgacgatcgacgtgtcgctggcggaggacacgcggtgggcgtcggccgggcacaccgtc
gcgaccggccagttcgaactcccgaccggcggcagcccgacggaaccgtcggccgaagtc
gcgccgctggcctgcgaggcgaccgacgacgggatcgtcgtttcgaacgtacacttcgaa
ctcgtcttcgacgagacggccggcgcgatcgattcgatgcgctaccggggacgagaactc
gtcaccgaggggccgacggtcggtctctggcgcgcgccgacggacaacgacagggggctg
ccgctctcgaggacgctcctctcgagaatgaccgcggccgccgcgggcgacggtcagatc
gacgagggtgacgtccacacgatcggcttcgcccaactctggcgagagcacgggctcgac
ggactccagttccgagcggacagcgtcgaatacgaggtcagcggcgacgaacgcgtcgag
atctccgtagagggacggctcgcgccgccgatcttcgaccacgggttcgcggtggagcag
gagtacacggtcgccgataccggcgccgtcgaaatcgagacggaactggagcccgagggc
gacctatccggccttccgtcgctgccgcgagtagggctcgatctgacgctcccggcggcg
ttcgatcgggtcagctggtacgggcgcgggccggacgaatcctacgtcgacagcaaacgg
gcgtcgctcgtcggccggtacgagcgcgacgtcgacgatctgcacacgccgtacgtcaga
ccgcaagcgaacgggaatcggacggacgtgcggtgggcggcgattaccgaccagcagggc
gtcggactgtacgtgagcggcgagtcgccgctgaacgtcacggcacaccgctacacgaga
gcggatctggaagcggccgaccacgtccacgaagtgccgcgacgggacgaggtctcggtg
tcgctagacgccgctcactgcgggctcggaaccggcagctgcggcccggaaacgctggag
ccgtaccgcgtcgagccgacgacctacgagttcacgatcgagcttcgaccgtacgtcgaa
gagtaa

DBGET integrated database retrieval system