KEGG   Halopiger xanaduensis: Halxa_0484Help
Entry
Halxa_0484        CDS       T01532                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hxa  Halopiger xanaduensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hxa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHALXA01:220562..222562
Genome map
AA seq 666 aa AA seqDB search
MSIGTCYFPEHWPSERWETDVQQMADAGLEYVRMGEFAWARLEPERGEFDFEWLETALEY
IGDHGMQAVLCTPTATPPRWLVDDHPDMLQEEPDGTTREFGGRRHYCFNSEAYALETDRI
VTRLAERFADHPVVAGWQTDNEYGCHGTIRCYCDDCSAAFSEWLQDRYGDIETLNEAWGT
TFWSQRYNDFDQIQPPRHSAASQHPSLLLDYYRFSSDSAVAYNERQVDILREADDDWFVT
HNFMSHFGPLDAYDVSESLDFASWDSYPTGHVQVQAQGEPSTDEYLVGSPDVTGLDHDLY
RSAADAPFWVMEQQPGDINWPPYSPQPAEGAMRLWAHHAVAHGADSVVYFRWRRCRQGQE
QYHAGLLEADGSPDRGYADAADAAADLESLPELEGSEASVAILHEYDNLWALNIQPHAPE
FDYWAHLETYYRALRKRGVAVDIVPPTRDLEDYAAVVAPTLHLVDDELATRLTEYVDGGG
NLLLTMRSGVKDRANQLLNEPAPGPLADLVGATVDAHEAPHPKQERALEYDGESFDYRVW
DEWLEPETATVTGTHRAGTAAGTPAITTNDVGDGRVRYCGVWPEDELADAIVTDLLEDAN
VATTPEPLPANVRAIGRNGYSWVLNFTGEERVLSLPTDASVVVGSDTVPAYDFAVVDTSV
TELEVE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcggaacgtgctactttccggaacactggccgagcgaacgatgggaaacggac
gtccaacagatggccgatgcaggcctcgagtacgtccggatgggcgagttcgcgtgggcg
cggttggaacccgaacgcggcgagttcgacttcgagtggctcgagacggctctcgagtat
atcggcgaccacggaatgcaagccgttctgtgtacgccgacggcgacgccgccgcggtgg
ctcgtcgacgaccatccggacatgctgcaggaagaaccggacgggacgacgcgcgagttc
ggcggtcgtcgccactactgctttaattccgaggcgtacgcgctagagacggatcgcatc
gtcacgcggctggcggaacggttcgccgaccaccccgtcgtcgccggctggcagaccgac
aacgagtacggctgtcacgggacgatccggtgttactgcgacgactgttcggcggcgttc
agcgagtggcttcaggaccggtacggcgacatcgaaacgctcaacgaggcgtggggaacg
acgttctggagccagcggtacaacgacttcgaccagattcagccgccgcgccactccgcg
gccagccagcacccgtcgctgctcctcgattactaccggttcagcagcgacagcgccgtc
gcgtacaacgagcggcaggtcgacattctacgagaggccgacgacgactggttcgtcacg
cacaacttcatgagccacttcggtccgctcgacgcgtacgacgtcagcgagagcctcgac
ttcgcttcgtgggactcctatccgaccggtcacgttcaggtccaggcccagggggaaccc
tcgaccgacgaatacctcgtcgggagtcccgacgtcaccggcctcgatcacgacctctac
cgctccgccgcggacgcgccgttctgggtgatggaacagcagcccggcgacatcaactgg
ccgccctattcgccccagcccgcggagggggcgatgcggctctgggcccaccacgccgtc
gcccacggcgccgacagcgtcgtctacttccgctggcgccgctgccggcaaggccaggag
cagtaccacgccgggctcctcgaggccgacggcagcccggatcgcggctacgccgacgcc
gccgacgcggctgccgacctcgagtcgcttccggagctcgagggatccgaggcgtcggtc
gcgatcctccacgagtacgacaacctctgggcgctgaacatccagccccacgcgcccgag
ttcgactactgggcccacctcgagacctactatcgagcgcttcgtaagcgcggtgtggcg
gtcgatatcgtgccgccgacgcgcgacctcgaggactacgccgccgtcgtcgcgccgacg
ctacacctcgtcgacgacgagctcgcgacgcggctcacggagtacgtcgacggcgggggg
aacctgctgctgacgatgcgctccggcgtcaaggatcgggcgaaccaactgctgaacgaa
ccggcgccgggcccgctcgcggacctcgtgggcgcgacggtcgacgctcacgaggcgccg
catccgaagcaggagcgcgcgctcgagtacgacggcgagtcgttcgactaccgcgtctgg
gacgagtggctcgagcccgagacggcgaccgtgaccggaacccaccgggccgggactgca
gccggcacccccgcgatcacgacgaacgacgtcggcgacggtcgcgtccgctactgcggc
gtctggccggaagacgaactggcggatgcgatcgtgaccgacctgctcgaggacgcgaac
gtggcgacgactccggagccactaccggcgaacgtccgcgccatcggtcgaaacggctac
tcgtgggtcctgaacttcacgggcgaggaacgggtcctctcgctgccgaccgatgcgtcg
gtagtagtgggctcggacacggttccagcgtacgatttcgctgtcgtcgatacgtcggtg
accgaactcgaggtcgagtaa

DBGET integrated database retrieval system