KEGG   Halopiger xanaduensis: Halxa_0879Help
Entry
Halxa_0879        CDS       T01532                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hxa  Halopiger xanaduensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halxa_0879
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halxa_0879
   00640 Propanoate metabolism
    Halxa_0879
   00660 C5-Branched dibasic acid metabolism
    Halxa_0879
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Halxa_0879
Enzymes [BR:hxa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Halxa_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(182644..183798)
Genome map
AA seq 384 aa AA seqDB search
MPMKLHEYQAKDVFADAGIPTPASQLASDVDGVIAAAEEIGYPVAVKAQVQVGGRGKAGG
IKLAEDEDEAREAAESILGMDLKGYRVDQVLVEEAVDFVNELYVGITMDRGEGKPVAMVS
TKGGVNIEEVAEEDPDAIAREHIDPSFGMHPYQARKAVYDAGVDQSVARDVSSVLTTLYD
LWDSRDGADAEINPLMVTSDDEVIAADAVMNIDEDALFRQPELAEMEEEASSGDELEQKA
DEYDFDYVRLEGNVGIIGNGAGLVMTTLDLVDHYGGQPANFLDVGGGAKAQRIANALDMV
FSDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNED
LVTVEQTLEDAVQRAVEYADEVEA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgaagcttcacgaatatcaggcgaaggacgtcttcgccgatgccggcattccg
acgccggcatcccaactcgcctccgacgtcgacggcgttatcgccgcggccgaggagatc
gggtatccagtcgcagtcaaggcgcaggtacaggtcggcggccgcgggaaggccggcggt
attaaactcgccgaggacgaggacgaggcccgcgaggcggccgagtccatcctcggaatg
gacctgaagggttaccgcgtggatcaggttctggtcgaggaagcggtcgacttcgttaac
gagctctacgtcggcatcacgatggaccgcggcgaaggcaagcccgtcgccatggtctcg
accaagggtggggttaacatcgaggaagtcgccgaggaggatcccgacgccatcgctcgg
gaacacatcgacccctccttcggcatgcatccgtaccaggcccgaaaggccgtctacgac
gccggcgtcgaccagtccgtcgcgcgcgacgtctcgagcgtcctcacgacgctgtacgat
ctctgggacagccgcgacggtgccgacgccgagatcaacccgctgatggttacttcggac
gacgaggtcatcgcggccgacgccgtgatgaacatcgacgaggacgcgctcttccgccag
cccgaactggccgaaatggaagaggaggcgtcctcgggcgacgaactcgagcagaaggcc
gacgagtacgacttcgactacgtccgcctcgaggggaacgtcggcatcatcggcaacggg
gccggtctcgtcatgaccacgctcgacctcgtcgaccactacggcggccagcccgccaac
ttcctggacgtcggcggtggcgcaaaggcgcagcgcatcgccaacgccctggacatggtc
ttctcggacgacaacgtcgactccgtcgtcttcaacatcttcggcgggatcacccgcggc
gacgaggtcgcccgggggatcaacgaggcgctcgagcagttcgacgaaatccccaagccg
gtcgtcgtccgcctggccggcaccaactgggaggaaggcatggagattctcaacgaagac
ctcgtgacggtcgagcagaccctcgaggacgcggttcagcgtgccgtcgaatacgctgac
gaggtggaagcatga

DBGET integrated database retrieval system