KEGG   Halopiger xanaduensis: Halxa_0924Help
Entry
Halxa_0924        CDS       T01532                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00220  Arginine biosynthesis
hxa00330  Arginine and proline metabolism
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01130  Biosynthesis of antibiotics
hxa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Halxa_0924
   00330 Arginine and proline metabolism
    Halxa_0924
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Halxa_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEH35560
JGI: Halxa_0924
UniProt: F8D8D7
Position
230359..231318
Genome map
AA seq 319 aa AA seqDB search
MNTNATVRIIGAPMDYGANRRGVDMGPSAIRYAGLADELERASVAPVDDGDLSMPRAEEI
DPDADDATGLESTGGESAGVENAKFLPEIESVNARLADRVAETLADGEFPLVLGGDHSVA
IGSLHGSARDADVGAIWFDAHADLNTPETSPSGNVHGMPLGAALGRGVFGDMDWAHSPRL
REESVAYVGLRSIDERERELVRESEMTAFTMSDIDQRGMTAVVEDALAVATDGTDGIHVS
LDLDMIDPKAAPGVGTPVRGGVTYREAHAALEAVSRRHDRDGILRSMDVVEVNPILDEAN
ETAALAAELTASAFGKRIL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaacgcgaccgttcggatcatcggcgcgccgatggactacggggccaaccgc
cgcggcgtcgacatgggaccctcggcgatccggtacgccggcctcgccgacgaactcgag
cgcgcgagcgtcgccccggtcgacgacggggacctctcgatgccgcgagcggaggagatc
gaccccgatgcggacgacgcaaccggactcgaatcgaccggcggggagagcgcgggcgtc
gagaacgccaagttcctcccggagatcgagagcgtcaacgcccgcctcgccgaccgcgtc
gcggagacgctggccgacggcgagttcccgctcgtgctcggcggcgaccactcggtcgcg
atcgggtcgctccacggctccgcgcgcgacgcggacgtcggcgcgatctggttcgacgcc
cacgccgacctcaacacgcccgaaacctcgcccagcggcaacgtccacgggatgccgctg
ggcgccgcgctcggtcggggcgtcttcggggacatggactgggcccacagcccccgcctc
cgggaggagtcggtcgcctacgtcggcctccgcagcatcgacgagcgcgagcgggaactg
gtccgcgagagcgagatgaccgcgttcacgatgtccgatatcgaccagcgcggcatgacg
gccgtcgtcgaggacgcgctcgcggtcgcgaccgacgggaccgacggtatccacgtcagc
ctcgacctcgacatgatcgatcccaaggccgcaccgggcgtcgggacgccggtccgcggc
ggcgtcacctaccgcgaggctcacgccgccctcgaggcagtctcgcggcgccacgatcgc
gacggaatcctccgctcgatggacgtcgtcgaagtcaacccgatcctcgacgaggccaac
gaaacggcggcgctcgcggccgagctcacggcgagcgcgttcggcaagcggattctctga

DBGET integrated database retrieval system