KEGG   Halopiger xanaduensis: Halxa_0924Help
Entry
Halxa_0924        CDS       T01532                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hxa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hxa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
230359..231318
Genome map
AA seq 319 aa AA seqDB search
MNTNATVRIIGAPMDYGANRRGVDMGPSAIRYAGLADELERASVAPVDDGDLSMPRAEEI
DPDADDATGLESTGGESAGVENAKFLPEIESVNARLADRVAETLADGEFPLVLGGDHSVA
IGSLHGSARDADVGAIWFDAHADLNTPETSPSGNVHGMPLGAALGRGVFGDMDWAHSPRL
REESVAYVGLRSIDERERELVRESEMTAFTMSDIDQRGMTAVVEDALAVATDGTDGIHVS
LDLDMIDPKAAPGVGTPVRGGVTYREAHAALEAVSRRHDRDGILRSMDVVEVNPILDEAN
ETAALAAELTASAFGKRIL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaacgcgaccgttcggatcatcggcgcgccgatggactacggggccaaccgc
cgcggcgtcgacatgggaccctcggcgatccggtacgccggcctcgccgacgaactcgag
cgcgcgagcgtcgccccggtcgacgacggggacctctcgatgccgcgagcggaggagatc
gaccccgatgcggacgacgcaaccggactcgaatcgaccggcggggagagcgcgggcgtc
gagaacgccaagttcctcccggagatcgagagcgtcaacgcccgcctcgccgaccgcgtc
gcggagacgctggccgacggcgagttcccgctcgtgctcggcggcgaccactcggtcgcg
atcgggtcgctccacggctccgcgcgcgacgcggacgtcggcgcgatctggttcgacgcc
cacgccgacctcaacacgcccgaaacctcgcccagcggcaacgtccacgggatgccgctg
ggcgccgcgctcggtcggggcgtcttcggggacatggactgggcccacagcccccgcctc
cgggaggagtcggtcgcctacgtcggcctccgcagcatcgacgagcgcgagcgggaactg
gtccgcgagagcgagatgaccgcgttcacgatgtccgatatcgaccagcgcggcatgacg
gccgtcgtcgaggacgcgctcgcggtcgcgaccgacgggaccgacggtatccacgtcagc
ctcgacctcgacatgatcgatcccaaggccgcaccgggcgtcgggacgccggtccgcggc
ggcgtcacctaccgcgaggctcacgccgccctcgaggcagtctcgcggcgccacgatcgc
gacggaatcctccgctcgatggacgtcgtcgaagtcaacccgatcctcgacgaggccaac
gaaacggcggcgctcgcggccgagctcacggcgagcgcgttcggcaagcggattctctga

DBGET integrated database retrieval system