KEGG   Halopiger xanaduensis: Halxa_1213Help
Entry
Halxa_1213        CDS       T01532                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00010  Glycolysis / Gluconeogenesis
hxa00030  Pentose phosphate pathway
hxa00051  Fructose and mannose metabolism
hxa00052  Galactose metabolism
hxa00230  Purine metabolism
hxa00500  Starch and sucrose metabolism
hxa00520  Amino sugar and nucleotide sugar metabolism
hxa00521  Streptomycin biosynthesis
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_1213
   00030 Pentose phosphate pathway
    Halxa_1213
   00051 Fructose and mannose metabolism
    Halxa_1213
   00052 Galactose metabolism
    Halxa_1213
   00500 Starch and sucrose metabolism
    Halxa_1213
   00520 Amino sugar and nucleotide sugar metabolism
    Halxa_1213
  Nucleotide metabolism
   00230 Purine metabolism
    Halxa_1213
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halxa_1213
Enzymes [BR:hxa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Halxa_1213
    5.4.2.8  phosphomannomutase
     Halxa_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_IV PGM_PMM_III
Motif
Other DBs
NCBI-ProteinID: AEH35846
JGI: Halxa_1213
UniProt: F8D6U9
Position
complement(533325..534689)
Genome map
AA seq 454 aa AA seqDB search
MEVFGSSGTRGVANEELTPAFVLRVAKAAGTAWGADRVGIARDTRYTGRMLADAAASGLA
STGTDVDRLGVVPTPGAQSYAEREGVPIVVITASHNPPQYNGVKLVGPDGIELSVSDLET
IEETLLTESFAVAPWDETGRVREVDGVTRDYVDELLAAADRDRIADADLTVALDPGHGAG
ALTSPEFFRELGCRVVTVNGQPDGHFPGRDPEPVPDNLEDLGRLVRATDADVGIAHDGDA
DRAIFFDEHGEYVEGDATLAALAAAELEDGDTTVSAVNVSQRLVDVVTEVGADLELTPIG
STNIITRIRELEDKGKRVPIAGEGNGGIFFPGFRLTRDGAFTAARFLELVAERPVSEIVG
PYGGYANVRRNIEYESTAERDAMLDAAANHAHAADAELNTRDGYRLDYGDAWVLARPSGT
EPLVRIYAEARDDDRATDLADEMYETLAEAKADA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttcggatccagcgggacgcgcggcgtcgcgaacgaggaactgacgcccgcg
ttcgtcctgcgcgtcgcgaaagcagccggaacggcgtggggggccgaccgggtggggatc
gcccgcgatacgcgatacaccgggcgaatgttagccgatgcggcggccagcggcctcgcc
agcacgggcaccgacgtcgaccggctcggcgtcgttcccacgccgggtgcacagtcctac
gccgaacgcgagggcgttccgatcgtcgtcatcaccgcctcgcacaacccgccccagtac
aacggcgtcaaactcgtcggccccgacggtatcgaactctcggtctcggacctcgagacg
atcgaggagaccctgctgacggagtcgttcgcggtcgccccgtgggacgagacgggccgc
gtccgcgaggtcgacggcgtcacgcgggactacgtcgacgaactgctcgcggcggccgac
cgcgaccggatcgccgacgccgacctcaccgtcgcgctcgatcccggccacggcgccggc
gcgctcaccagccccgagttcttccgcgaactgggctgtcgcgtcgtcaccgtcaacggc
cagcccgacggccacttccccggccgcgatcccgaacccgtcccggacaacctcgaggac
ctcgggcgcctcgtccgagcgaccgacgccgacgtcggcatcgcccacgacggcgacgcc
gaccgcgcgatcttcttcgacgaacacggcgagtacgtcgagggcgacgccaccctcgcc
gcgctcgcggccgcggaactcgaggacggcgacacgacggtctccgcagtgaacgtctcc
caacggctcgtcgacgtcgtcaccgaggtcggcgccgacctcgagctgacgccgatcggc
tcgacgaacatcatcacccgcatccgcgaactcgaggacaagggcaagcgagtgccgatc
gcgggcgagggcaacggcgggatcttcttccccggattccgcctcacgcgcgacggtgcg
ttcaccgccgcgcggttcctcgaactcgtcgcggagcgtccggtcagcgagatcgtcgga
ccctacggcggctacgccaacgtgcggcgcaacatcgagtacgagtcgaccgcggagcgc
gacgccatgctggacgcggccgcgaaccacgcccacgccgccgacgcggaactcaacacc
cgcgacggctaccgcctggattacggcgacgcgtgggtgctggcccgcccctccggcacg
gagccgctcgtccgcatctacgccgaagcccgcgacgacgaccgcgcgaccgacctggcc
gacgagatgtacgagacgctcgccgaggcgaaagccgacgcctga

DBGET integrated database retrieval system