KEGG   Halopiger xanaduensis: Halxa_1465Help
Entry
Halxa_1465        CDS       T01532                                 

Definition
molecular chaperone GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Halxa_1465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_1465
  Lipid metabolism
   00071 Fatty acid degradation
    Halxa_1465
  Amino acid metabolism
   00350 Tyrosine metabolism
    Halxa_1465
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halxa_1465
   00626 Naphthalene degradation
    Halxa_1465
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Halxa_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(771525..772568)
Genome map
AA seq 347 aa AA seqDB search
MQAARLHEYTDDMSEALRIDDVDRPELERSDQVLVEVEGAGWCQTDNHIIEGMWADYAPQ
DLPMTLGHENAGIVAETGEEVTLVEEGDPVICHPVQTCGICRPCRLGEDMYCENSAFNGL
TTDGGFAEFLQTNERAVIPLPDGIDPTEIAPHADAGITAYHAAKKAVDELNPGDACVVIG
IGGLGHIGLQCLEAMSAADILAVDVKDEALELAEDLGARHTVNSAEEDLADAVADLTDDE
GAQQVLDFVGADETTGAAPDIVAAGGDHHIIGYGGHIHEPCQALVDGEFSFKGTLVGQYA
ELQELVALVDRGDVELRTERYDLADINAVAERLEHNEIEGRAVVTPP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcccgactccacgagtacaccgacgacatgagcgaggcgctgcggatcgac
gacgtcgaccgcccggaactcgagcgctccgatcaggtgctggtcgaggtcgagggcgcg
ggctggtgccagacggacaaccacatcatcgaggggatgtgggcggactacgcgccccag
gacctgccgatgacgctgggccacgagaacgccggcatcgtcgccgagacgggcgaggag
gtgaccctggtcgaggaaggcgatcccgtgatctgtcaccccgtccagacctgcggcatc
tgtcggccctgccggctcggcgaggacatgtactgcgagaattcggcgttcaacggcctc
acaaccgacggcggcttcgccgagttcctccagaccaacgagcgcgcggtgatcccgctg
cccgacggcatcgatccgaccgagatcgcaccccacgccgacgcggggatcacggcctac
cacgccgccaagaaggccgtcgacgaactgaaccccggcgacgcctgcgtcgtcatcggc
atcggcggcctcggccacatcggcctccagtgtctcgaggcgatgagcgccgccgacatc
ctcgccgtcgacgtcaaggacgaagcgctcgagttggccgaggacctcggcgcgcgacac
acggtcaactccgccgaggaggacctcgccgacgccgtcgcggacctgaccgacgacgag
ggcgcccagcaggtgctcgacttcgtgggcgccgacgagacgaccggcgccgcgcccgac
atcgtcgccgccggcggcgaccaccacatcatcggctacggcggccacatccacgaaccc
tgccaggcgcttgtcgacggcgagttctccttcaagggcacgctcgtcggccagtacgcc
gaactgcaggaactcgtcgcgctggtcgaccgcggcgacgtcgaactgcggaccgagcgg
tacgatctggcggatatcaacgcggtcgcggagcgcctcgagcacaacgagatcgagggg
cgagcggtcgtgacgccgccctga

DBGET integrated database retrieval system