KEGG   Halopiger xanaduensis: Halxa_1473Help
Entry
Halxa_1473        CDS       T01532                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hxa  Halopiger xanaduensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halxa_1473
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Halxa_1473
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halxa_1473
Enzymes [BR:hxa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Halxa_1473
Exosome [BR:hxa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halxa_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
780998..782563
Genome map
AA seq 521 aa AA seqDB search
MRRRQFVTALGATGLLGATGAVGAESAGGNGRRGSDIENVIVLIGDGMGFDPIEVTSVVH
GDLSLQSMTGVGYTRTNSRSGEVTDSAAAGTALATGHKAFNGQVSVRGDEDYEDPTPLVT
QLELAQAQGKATGLVSTTRITHATPAVYASHVPDRDMEAAIAQQYVESDVDVLMGGGRRE
FDDALLDRARNAGYEVLFDESDLEAASGDRLLGLFDDSHITYTLDRDESIPSLPAMTAAA
VDRLEGGDDGFFLMVEGGRIDHAEHGNDIQTTVAETKEFDAVVDWALEYAEGRDDTLVVV
ASDHETGGLATGNDYGSPIDAEAIRNARASNAAIAESIEGGKPVRETVEAHVDVDLTDED
VARIEDVVGADDPYALSNELGAVVSDHLGVSWASNVHTGPAQTVMAAGADVDPFNGWIHH
TDLSVTVTALLLFGRLPDVSENEREAWEQKVVKNGPKGRRDAALALEYVGPVTDDVTKAL
DRDGNGVVDYGDVLSILEGDSPSPSAKASHRREAPYSAHDV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgacgacaattcgtcacggctctgggtgcgactggactcctcggcgcaaccggc
gcggtcggcgcggagtcggccggcgggaacggccgtcgaggaagtgatatcgagaacgtg
atcgtcctgatcggcgacggcatggggttcgacccgatcgaggtcacgtcggtcgtccac
ggcgatctgtcgctgcagtcgatgaccggcgtcggctacactcggacaaactcccgcagc
ggggaggttaccgactccgcggcggccgggaccgcgctcgcgacgggccacaaggcgttc
aacggacaggtctccgtccgcggcgacgaggactacgaggatccgacgccgctggtgacc
cagctcgagctggcacaggcacaggggaaggcgacaggcttggtctcgacgacccggatc
acccacgcgacgccggccgtctacgcctcccacgtccccgatcgcgacatggaggcggcg
atcgcacagcagtacgtcgagagcgacgtcgacgtgctcatgggcggcggtcgccgcgag
ttcgacgacgcgttgctcgatcgggcgcggaacgcgggctacgaagtcctgttcgacgag
agcgacctcgaagccgccagcggcgatcgtttgctcggcctgttcgacgacagccacatc
acctacaccctcgaccgcgacgagtcgatcccctcgctgcccgcgatgaccgccgccgcg
gtcgaccgcctcgaagggggcgacgacggcttcttcctgatggtcgagggcggccggatc
gatcacgccgaacacggcaacgacatccagacgacggtcgccgagacgaaggagttcgac
gcggtcgtcgactgggcgctcgagtacgccgagggccgcgacgacacgctggtcgtcgtc
gcctccgaccacgagaccggcgggctggcgaccggcaacgactacgggtcgccgatcgac
gcggaggcgatccggaacgcgcgggcgagcaacgcggccatcgccgagtctatcgagggc
ggcaaaccggtgcgcgagacggtcgaagcgcacgtcgacgtcgacctcaccgacgaggac
gtcgcgcggatcgaggacgtcgtcggcgccgacgatccctacgccctctcgaacgaactc
ggggcggtcgtctccgaccacctcggcgtctcgtgggcctcgaacgtccacaccggcccg
gcacagacggtcatggccgccggcgccgacgtcgacccgttcaacggctggatccaccac
accgacctctcggtgaccgtcaccgcactgctgctgttcggtcgcctccccgacgtctcc
gagaacgagcgcgaggcctgggaacaaaaggtcgtcaagaacggtccgaagggccgtcgc
gacgccgccctcgccctcgaatacgtcggtcccgtcaccgacgacgtgacgaaggcgctc
gatcgcgacggcaacggcgtcgtcgactacggggacgttctcagtatcctcgagggtgat
tccccgtccccgtcggcgaaggcgagtcaccgccgcgaggctccctactcggcccacgac
gtgtag

DBGET integrated database retrieval system