KEGG   Halopiger xanaduensis: Halxa_1642Help
Entry
Halxa_1642        CDS       T01532                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00010  Glycolysis / Gluconeogenesis
hxa01100  Metabolic pathways
hxa01110  Biosynthesis of secondary metabolites
hxa01120  Microbial metabolism in diverse environments
hxa01130  Biosynthesis of antibiotics
hxa01200  Carbon metabolism
hxa01230  Biosynthesis of amino acids
Module
hxa_M00002  Glycolysis, core module involving three-carbon compounds
hxa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
hxa_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halxa_1642
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Halxa_1642
Membrane trafficking [BR:hxa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Halxa_1642
Exosome [BR:hxa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Halxa_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEH36274
JGI: Halxa_1642
UniProt: F8D420
Position
956025..957098
Genome map
AA seq 357 aa AA seqDB search
MSEHSYSGGAGSDGALRIGLNGFGRIGRNVLRASLSDDNVEIVAINDVMDADDMEYLLRY
DSVHGRLDDVSRDGDTLHIGDREIELLSERDPAQLPWDELDIDVAFEATGLFRTYDDAAQ
HLEAGADKVVISAPPKGEKEVPMFVYGVNHDEYDGEDIVSNASCTTNSVAPVAKVLDEEF
GIESGLLTTVHAYTGTQSIVDGPSSKRRRGRAAAENIIPTTTGAAIAATEVLPELEGKLD
GMAIRVPVPNGSITDFTVDLEEDVTKEELEEAFRDAADNELAGILGYTDEEIVSRDIIGL
PFSSYVDLEASMVLEDGLVKVLTWYDNEYGFSNRMLDLATYVAAEADDVDAEEAVAQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacattcgtacagcggtggcgcggggtcggacggagcgcttcgaatcggcctc
aacgggttcggccgaatcgggcgaaacgtcctgcgtgcgtcgctgtccgacgacaacgtc
gagatcgtcgccatcaacgacgtgatggacgcggacgacatggagtatctgctccgatac
gactcggtccacggccgactcgacgacgtttcccgcgacggcgacacgctccacatcggc
gaccgcgagatcgaactgctctccgagcgcgacccggcccaactgccctgggacgaactc
gacatcgacgtcgccttcgaggcgaccggcctgttccgtacctacgacgacgccgcccag
caccttgaagccggcgccgacaaggtcgtcatctcggcgccgccgaagggcgagaaggag
gttccgatgttcgtctacggcgtcaaccacgacgagtacgacggcgaagacatcgtctcg
aacgcctcctgtaccacgaactccgtcgcgccggtcgcgaaggtgctcgacgaggagttc
ggcatcgagtccggtctgctgacgaccgtccacgcctacaccggcacgcagagcatcgtc
gacggtccgagcagcaagcgccgccgcggccgcgccgccgccgagaacatcatcccgacc
accacgggcgccgccatcgcggccaccgaagtcctgcccgaactcgagggcaagctcgac
gggatggcgatccgcgtccccgtcccgaacggctcgatcacggacttcaccgtcgacctc
gaggaggacgtcacgaaggaggaactcgaggaagcgttccgcgacgcggcagataacgaa
ctcgccggcatcctgggctacaccgacgaggaaatcgtctcgcgggacatcatcggcctg
ccgttctcctcgtacgtcgacctggaggcctcgatggtgctggaggacggcctcgtgaag
gtcctgacctggtacgacaacgagtacggcttctcgaaccggatgctcgacctcgcgacg
tacgtcgccgccgaagcggacgacgtcgacgccgaggaagcggtcgcacagtaa

DBGET integrated database retrieval system