KEGG   Halopiger xanaduensis: Halxa_1650Help
Entry
Halxa_1650        CDS       T01532                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hxa  Halopiger xanaduensis
Brite
Enzymes [BR:hxa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Halxa_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD CMAS GCD14 Fibrillarin DUF938 Methyltransf_18 Methyltransf_32 DOT1 Methyltransf_23 MTS DUF2795
Motif
Other DBs
NCBI-ProteinID: AEH36282
JGI: Halxa_1650
UniProt: F8D426
Position
964467..965141
Genome map
AA seq 224 aa AA seqDB search
MFDRFRSSADGDADSDDGEYEAARERMVRTVAHRVADDRVLEALEDVPRHEFVPPDRRGE
AYADRPLPIGDGQTISAPHMVAVMADRLDLEPGDEVLEIGTGCGYHAAVTAEIVGPENVY
SVEYGEQLAEQARARLEEIGYGEIDVRIGDGRNGWAEQAPYDAAYFTCATAELPEPVVEQ
VRPGGRILAPVGTGRQTLVQADKRADGSLERTEHGGVRFVQMRG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcggttccgctcgagcgccgacggcgacgccgactccgacgacggcgagtac
gaggccgcccgcgagcgcatggttcgaaccgtcgcccacagagtcgcggacgatcgggtc
ctcgaggccctcgaggacgtcccgcgccacgagttcgtcccgccggatcgacggggcgag
gcctacgcggatcgcccgctgccgatcggggacggacagacgatcagcgcgccccacatg
gtcgcggtcatggccgaccggctcgacctcgagcccggcgacgaggtcctcgagatcggc
accggctgcggctaccacgcggccgtcaccgccgagatcgtcggaccggagaacgtctac
agcgtcgagtacggcgagcaactcgccgagcaggcccgagcacggctcgaggaaatcgga
tacggcgagatcgacgtccgcatcggcgacggccgcaacggttgggcggaacaggccccc
tacgacgcggcgtacttcacctgcgcgacggcggaacttccggagccggtcgtcgaacaa
gtccgccccggcggccgcatcctcgcacccgtcgggaccggccgccagacgctcgtccag
gccgacaagcgcgcggacggctcgctcgagcggacggaacacggcggcgtccggttcgtg
cagatgcgcggctga

DBGET integrated database retrieval system