KEGG   Halopiger xanaduensis: Halxa_1650Help
Entry
Halxa_1650        CDS       T01532                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hxa  Halopiger xanaduensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
964467..965141
Genome map
AA seq 224 aa AA seqDB search
MFDRFRSSADGDADSDDGEYEAARERMVRTVAHRVADDRVLEALEDVPRHEFVPPDRRGE
AYADRPLPIGDGQTISAPHMVAVMADRLDLEPGDEVLEIGTGCGYHAAVTAEIVGPENVY
SVEYGEQLAEQARARLEEIGYGEIDVRIGDGRNGWAEQAPYDAAYFTCATAELPEPVVEQ
VRPGGRILAPVGTGRQTLVQADKRADGSLERTEHGGVRFVQMRG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcggttccgctcgagcgccgacggcgacgccgactccgacgacggcgagtac
gaggccgcccgcgagcgcatggttcgaaccgtcgcccacagagtcgcggacgatcgggtc
ctcgaggccctcgaggacgtcccgcgccacgagttcgtcccgccggatcgacggggcgag
gcctacgcggatcgcccgctgccgatcggggacggacagacgatcagcgcgccccacatg
gtcgcggtcatggccgaccggctcgacctcgagcccggcgacgaggtcctcgagatcggc
accggctgcggctaccacgcggccgtcaccgccgagatcgtcggaccggagaacgtctac
agcgtcgagtacggcgagcaactcgccgagcaggcccgagcacggctcgaggaaatcgga
tacggcgagatcgacgtccgcatcggcgacggccgcaacggttgggcggaacaggccccc
tacgacgcggcgtacttcacctgcgcgacggcggaacttccggagccggtcgtcgaacaa
gtccgccccggcggccgcatcctcgcacccgtcgggaccggccgccagacgctcgtccag
gccgacaagcgcgcggacggctcgctcgagcggacggaacacggcggcgtccggttcgtg
cagatgcgcggctga

DBGET integrated database retrieval system