KEGG   Halopiger xanaduensis: Halxa_1651Help
Entry
Halxa_1651        CDS       T01532                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hxa  Halopiger xanaduensis
Brite
Enzymes [BR:hxa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Halxa_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
965249..966010
Genome map
AA seq 253 aa AA seqDB search
MDPAVLREDMVDGLESAAKDVLRDEAVAVAMRDVPRHEFVDDERAAYADREHEVFGTRVL
APSTAARMLQALDLEEGHSVLIVGAGVGYTAAVAAELAGEANVHAIDIARPLVYEARGNL
ASAGYEGVLVDRRDGADGLPEYAPFDRILLEAAAVDPPRALRKQLADDGRLVLPRGSQSQ
RLEVVTADGDRERRGPVAFDPLLVEGEQSGAVERNRTAREDVEHAQRRAESRRGWEQDWI
EWDEAIDSQSRPR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcggtactccgggaagacatggtcgacggcctcgagtccgccgcgaaggac
gtcctccgggacgaggccgtcgccgtcgccatgcgcgacgtgccccgccacgagttcgtc
gacgacgagcgagcggcctacgccgatcgcgagcacgaagtcttcggcacccgcgtgctc
gcaccgagcacggccgcccgcatgctgcaggcgctcgacctcgaggagggtcactccgta
ctgatcgtcggcgcgggcgtcggctacacggccgccgtcgctgccgaactcgccggcgag
gcgaacgtccacgcgatcgacatcgcccgcccgctcgtctacgaagcgcggggcaacctc
gcgtcggccggctacgagggcgtcctcgtcgaccgccgcgacggcgccgacggcctcccc
gagtacgccccgttcgaccgcatcctgctcgaggccgcggccgtcgacccgccgcgggcg
ctgcgcaagcaactggccgacgacggccgcctcgtactcccgcggggctcgcagtcgcaa
cgtctcgaggtcgtgacggccgacggcgatcgcgagcggcgcggccccgtcgccttcgat
ccgctgctcgtggagggcgaacagtccggcgccgtcgagcgcaatcggacggcccgcgag
gacgtcgagcacgcccagcgccgcgcggagtcgcgccggggctgggaacaggactggatc
gagtgggacgaagcgatcgactcgcagtcacggccgcggtaa

DBGET integrated database retrieval system