KEGG   Halopiger xanaduensis: Halxa_1682Help
Entry
Halxa_1682        CDS       T01532                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hxa  Halopiger xanaduensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Halxa_1682
Enzymes [BR:hxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Halxa_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
998762..999652
Genome map
AA seq 296 aa AA seqDB search
MVRVLSAGHVNWDVTLRVDRLPEADGEASIRSQRQSGGGSAANVAAALAGLEVDAGLIGS
VGDDDNGVLARRDLESAGVDLEGVRIVEAGQTAVKYLLVDDDGEVAVLGNDGVNEAVGPE
EIDERRIRNADHVHLTSQRPDTAAAIARTANEAGVTVSFDPGRRLGDRDYGEALAAADVL
FANDRELAALLEDEYEYVGSDFDDRIVAVKHGSDGAEVHTPTGSYVHPGFDVDAVDTAGA
GDAFAAGFIATWLTDGDVERALEYANACGALTAGREGARSAPTADAVAAFLSERFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtacgggtactctccgccggtcacgtcaactgggacgtgaccctccgcgtcgatcgg
ctccccgaagccgacggcgaggcgtcgatccgctcgcaacgtcagtccggcggcggcagc
gcggctaacgtcgccgccgccctcgccggcctcgaggtcgacgccggtctgatcggcagc
gtcggcgacgacgacaacggcgtcctcgcgcgacgcgacctcgagtccgcgggcgtcgac
ctcgagggcgtccggatcgtcgaagcgggccagacggccgtcaagtacctgctcgtcgac
gacgacggcgaggtcgcggtgctcggcaacgacggcgtcaacgaggccgtcggcccggag
gaaatcgacgagcgtcggattcggaacgccgaccacgtccacctcacgagtcagcgtccc
gacaccgccgccgccatcgcgcgaacggcgaacgaggccggggtcaccgtcagtttcgac
cccggccgccggctcggggaccgcgactacggcgaggcgctcgcggccgcggacgtcctc
ttcgcgaacgaccgggaactcgcggcgctgctcgaggacgagtacgagtacgtcggctcc
gacttcgacgaccggatcgtcgccgtcaaacacgggtccgacggcgcggaagtgcacacg
ccgaccggctcgtacgtccacccgggattcgacgtcgacgcggtcgacacggccggcgcg
ggcgacgccttcgccgccgggttcatcgcgacctggctcaccgacggcgacgtcgaacgc
gcgctcgagtacgcgaacgcctgcggcgcgctgacggccggccgagagggggcgcgcagc
gcgccgacggcggatgcggtcgcggcgtttctcagcgagcggtttgattaa

DBGET integrated database retrieval system