KEGG   Halopiger xanaduensis: Halxa_1711Help
Entry
Halxa_1711        CDS       T01532                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hxa  Halopiger xanaduensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hxa01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hxa00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1027195..1029132
Genome map
AA seq 645 aa AA seqDB search
MTELGGFQDRVARIDLSDGDVAYESIDDEDAKKYIGARGLGVKYVFEQGPDVDPLGPDNL
LAFMNGPLSGTQVTMSGRIAVCTKSPLTGTVTDSHQGGWSGARLKWSGFDGLLFEGQADE
PVYAFVEDGEVELRDASHLWGMGFHEARDAIEEEVDGSYGKNLSIMGIGPGGENQVRYAT
IMNEDDRASGRGGVGCVAGSKNLKAVVVKSGTKMPKPADKETFMEGHQQAMQVIQESDVT
APNEGGLSKFGTNVLMNLTEEMSGLPTRNGKYTSTRDAREDGFAGDEFDSEQVSGENVRE
NILVDEPTCHSCPVACKKEVEVQTMHKGEEMNVRTESYEYESAFALGPNSGHTERDDIAL
MIDRCNDMGVDTIEVGNMMAMAMEMTEEGKLEDLDHDMDWGDSEEMVDMIERIAHRETDL
ADLLAEGADRIAEQMDAHENSLAVKGQTIPAYDPRCMKGMGIGYATSNRGACHLRGYTPA
AEILGIPEKVDPYEWEGKGELTAEFQDLHAISDSFDICKFNAFAEGIEEYVLQYNGMTGL
DVSEDELMEAGERVYNLERYYNNLAGFDGSDDSLPDRFLPDGIPGQGASEGEHCELEPMK
EEYYDYRGWVDGVVPDEKLDELDIEVGPGTGVSAGDGAAAAPSDD
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactcggcggtttccaagacagggtcgctcgcatcgacctctcggacggggac
gtcgcgtacgagtcgatcgacgacgaggacgcgaagaagtatatcggtgcgcgcggcctc
ggggtgaagtacgtattcgaacagggaccggacgtcgatccgctcggacccgacaacctg
ctggccttcatgaacgggccgctgtcgggcacgcaggtaacgatgagcggccggatcgcc
gtctgcaccaagtcgccgctgaccggcaccgtcaccgacagtcaccagggcggttggtcc
ggcgcgcgactcaagtggtccggcttcgacggcctgcttttcgagggtcaggccgacgaa
ccggtctacgccttcgtcgaggacggcgaggtcgaacttcgggacgcgtcccacctctgg
gggatgggcttccacgaggctcgcgacgcgatcgaagaggaggtcgacggctcctacggc
aagaacctgagcatcatggggatcggccccggcggcgagaaccaggttcgctacgccacg
atcatgaacgaggacgaccgcgcctcgggtcgcggcggggtcggctgcgtcgccggctcg
aagaacctcaaggcggtcgtcgtcaaatcgggcacgaagatgcccaaacccgcggacaag
gagacgttcatggagggccaccagcaggccatgcaggtcatccaggagtcggacgtcacc
gcgcccaacgagggcgggctctcgaagttcggcaccaacgtcctcatgaacctcaccgag
gagatgtctgggctcccgacccgcaacgggaagtacacttcgacgcgggacgcccgcgag
gacggcttcgccggcgacgagttcgactccgagcaggtctccggcgagaacgttcgcgag
aacatcctcgtcgacgaacccacgtgtcactcctgtcccgtcgcctgcaagaaggaagtc
gaagtccagacgatgcacaagggcgaggagatgaacgtccggacggagtcctacgagtac
gagtccgcgttcgcgctgggccccaactccggtcacaccgagcgcgacgacatcgcgctg
atgatcgaccgctgtaacgacatgggcgtcgacaccatcgaggtcggcaacatgatggcg
atggccatggagatgaccgaggagggcaaactcgaggacttagaccacgacatggactgg
ggcgactccgaggagatggtcgacatgatcgagcggatcgcccaccgcgagaccgacctc
gcggacctgctggccgagggcgccgaccgtatcgcagagcagatggacgcccacgagaac
tccctggccgtcaagggccagaccatccccgcctacgacccgcgctgcatgaaggggatg
ggcatcggctacgccacctcgaaccgcggggcctgccacctgcgcggctacacgcccgcc
gccgaaattctcggcatccccgagaaggtcgatccctacgagtgggagggcaagggcgaa
ctgaccgcggagttccaggacctgcacgccatcagcgactccttcgacatctgcaagttc
aacgccttcgcggagggcatcgaggagtacgtcctccagtacaacggcatgaccggcctg
gacgtctccgaggacgagctgatggaggccggcgagcgcgtctacaacttagagcgctac
tacaacaacctcgccggcttcgacggctccgacgattcgctgccggaccggttcctgccg
gacggcatccccggccagggcgccagcgagggcgagcactgcgaactcgagccgatgaaa
gaggagtactacgactaccgcggctgggtcgacggcgtcgtgcccgacgagaaactcgac
gaactcgacatcgaagtcggtccagggacgggcgtcagcgccggcgacggcgcggcggcg
gctccgagcgacgactaa

DBGET integrated database retrieval system