KEGG   Halopiger xanaduensis: Halxa_1765Help
Entry
Halxa_1765        CDS       T01532                                 

Definition
Nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hxa  Halopiger xanaduensis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hxa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Halxa_1765
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Halxa_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1079119..1081020
Genome map
AA seq 633 aa AA seqDB search
MTDEPTSPTQDSSETDAGTEREPLFDRIPRRDFMKAGAAAGAMGSLAGCTGLLSDQDDGL
ASASDVDASVPPGEHDDYYAFLSGGHSGEIRVYGVPSMRQLMRIPVFGRESARGYGFDDR
TSEMLEDAGGYSWGDTHHPRVSQTDNDYDGRWAFVNDKANGRMARINLKYFETDAIVDIP
NQQGTHGACCLLPDTKYVFGVGEFRVPMPNDGRDLTDPDSYTSTIAAIDPETMNVEWEVL
VDGNMDNGDGGKEGRWFFATGYNSENATTESEMSSSDTDWLKAFDVPAIEEAVENGQYEE
IGGVPVVDGTRDSDLNGGDRPIVRYIDVAKSPHGVSVTPDNKYAIASGKLDPTCSVIDIE
QLAEVDDPNDAIVGRPSLGMGPLHTAYDGRGHAYTTLFIDSQVVKWDIEAAVEAEAQSED
PVVEKIDVHYNPGHLIASESYTADPQGDWLISLNKLSKDRFLNVGPQKPENDQLIYIGDD
EEGMQLVKDTPSYAEPHDASIVSADKIQPADIYDPADYEEEYVDHGESEVVREDGRAHVK
MYSTRNEFGLHEVTVQEGDEVTMTVTNIEQTPDILHSLAIPEHDINIKLAPQETREVTFT
ADEPGVYWMYCAFFCSALHLEMRSRLIVEPADE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaacctacttcccccacgcaggactcgagcgagaccgacgcgggcaccgag
cgagaaccgctgttcgatcgcattccgcgccgcgacttcatgaaggcaggtgcagccgcc
ggtgcgatgggctcgctcgccggctgtacgggcctgctcagcgaccaggacgacgggctg
gcctcggcgtccgacgtcgatgcgagcgtgccgccgggcgagcacgacgactactacgcg
ttcctctccggcggtcactccggcgagatccgcgtctacggcgtgccgtcgatgcggcaa
ctgatgcgcattcccgtcttcggccgggagagcgcccgcggctacggcttcgacgaccga
acgagcgagatgctcgaggacgcgggcggctactcgtggggcgacacccaccacccgcgc
gtgagccagacggacaacgactacgacggccgctgggcgttcgtcaacgacaaggcgaac
ggccggatggcccggatcaacctcaaatacttcgagacggacgccatcgtcgacattccg
aaccagcaggggacccacggcgcctgctgtctgctgccggacacgaagtacgtcttcggc
gtcggcgagttccgcgtcccgatgcccaacgacgggcgggacctcaccgatcccgacagc
tacacgtcgactatcgccgccatcgaccccgagacgatgaacgtcgagtgggaggtgctg
gtcgacggtaacatggacaacggcgacggcggcaaggagggacggtggttcttcgcgacc
ggctacaacagcgagaacgccaccaccgaaagcgagatgtcctcctcggacaccgactgg
ctgaaagccttcgacgtgcccgccatcgaggaggccgtcgagaacggccagtacgaggag
atcggcggcgtcccggtcgtcgacggcacccgcgacagcgacctgaacggcggcgaccga
ccgatcgtccgctacatcgacgttgcgaagagcccccacggggtcagcgtcacgccggac
aacaagtacgcgatcgccagcggcaagctcgaccccacgtgctcggtgatcgacatcgag
caactcgccgaggtcgacgaccccaacgacgcgatcgtcggccggccgagcctcggaatg
gggccgctgcacaccgcctacgacggccgcggccacgcctacacgacgctgtttatcgac
tcgcaggtcgtcaagtgggacatcgaggccgccgtcgaggccgaggcccagtccgaagat
ccggtcgtcgagaagatcgacgtccactacaaccccggccacctgatcgccagcgaatcg
tacacggccgatccgcagggcgactggctgatctcgctgaacaagctctcgaaggaccgg
ttcctgaacgtcggcccgcaaaaacccgaaaacgaccagctgatctacatcggggacgac
gaggaggggatgcagctcgtgaaggacacgccctcctacgccgaaccgcacgacgcgtcg
atcgtcagcgcggacaagatccagcccgcggacatctacgaccccgcggactacgaggag
gagtacgtcgaccacggcgagtctgaagtcgttcgcgaggacgggagggcccacgtgaag
atgtactcgacgcgcaacgagttcggcctccacgaagtgaccgtccaggagggcgacgag
gtgacgatgaccgtcaccaacatcgagcagacgccggacatcctccattcgctggcgatc
cccgagcacgacatcaacatcaagctcgcaccgcaggaaacccgcgaggtcaccttcacg
gccgacgagcccggcgtctactggatgtactgtgcgttcttctgcagcgcgctgcacctc
gagatgcgctcgcgactgatcgtcgaacccgcggacgagtaa

DBGET integrated database retrieval system