KEGG   Halopiger xanaduensis: Halxa_2141Help
Entry
Halxa_2141        CDS       T01532                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hxa  Halopiger xanaduensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hxa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1468690..1469553
Genome map
AA seq 287 aa AA seqDB search
MFPGAADEREGTDAVGTADRGDANFVVVGAPLDATTTFQPGTRFGPRRIRSFAEPFDDYD
RRTDQHFSELGVVDRGDVRAWDDLEEYLEYLTSTLREAVWNDAVPLLLGGEHTVSLAGAR
AVNPEVFVCLDAHLDCYDAYDGNPLSHAAVTRRILEDVDSVEEAVILGARTGSEAEWERA
DADDVTVVPPEDVVQFTCEHLEDRVTDCEAYLSVDIDAADPGYAPGTGTTEPFGLEPREL
RDVVRTVAPHAGGFDVVEVNDRDDGQAASLAGKLVREFVFSNAAERL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggggcggctgacgaacgcgaggggaccgacgcggtgggtactgccgaccgt
ggagatgcgaacttcgttgtcgtcggtgcgcccttggacgccacgacgacctttcaaccc
gggacccgattcgggccccgacggatccgttcttttgccgaaccgttcgacgactacgac
cgcaggacggaccagcatttctccgaactcggcgtcgtcgaccgcggcgacgtccgtgcg
tgggacgacctcgaggagtacctcgagtacctgacgagcacgctgcgcgaagcggtctgg
aacgacgccgtgccgctcctgctgggcggcgaacacaccgtctcgctggccggcgcgcgc
gccgtcaaccccgaggtgttcgtctgtctggacgcccacctcgactgctacgacgcctac
gacggcaatccactctcgcacgccgccgtcacccggcggatcctcgaggacgtcgactcg
gtcgaggaagccgtcatcctcggcgcccgaacggggagcgaagctgagtgggaacgagcc
gacgcggacgacgtgaccgtcgtcccgcccgaggacgtcgtgcagttcacgtgcgaacac
ctagaggaccgcgtcaccgactgcgaggcctacctgagcgtcgatatcgacgccgccgat
cccggctacgcacccggaacggggacgacggaaccgttcggcctcgagccccgcgagcta
cgcgacgtcgtgcgcactgttgccccgcacgccggcggcttcgacgtcgtggaggtcaac
gaccgcgacgacggccaggccgcgtcgctggccggcaagctggtcagagagttcgtcttt
tccaacgccgccgagcggctgtga

DBGET integrated database retrieval system